Product
Supplier
Encyclopedia
Inquiry
Home > Biochemical Engineering > Polypeptide > LL-37 for Sale > Pinealon| TongPeptides | 99% Purity |PI5
Pinealon| TongPeptides | 99% Purity |PI5 buy - large image1
Pinealon| TongPeptides | 99% Purity |PI5 buy - image1
Pinealon| TongPeptides | 99% Purity |PI5 buy - image2
Pinealon| TongPeptides | 99% Purity |PI5 buy - image3
Pinealon| TongPeptides | 99% Purity |PI5 buy - image4
Pinealon| TongPeptides | 99% Purity |PI5 buy - image5
Pinealon| TongPeptides | 99% Purity |PI5 buy - image6

Pinealon| TongPeptides | 99% Purity |PI5

TDS 3 Inquiries

Unit Price:

$4/UNIT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99.5%

Port:

china

Brand:

Tongpeptide

Packaging:

mg*10vials

Price valid (until):

2026-09-13

Company Type:
Manufactory
Location:
China
Qualification:
Main Products:

retatrutide,TB-500,GHK-CU,peptide

  • Product Description

  • Seller Information

  • Inquiry History

  • Description

    Descriptiopn


    Name:Alice

    Whatsapp:+852 5513 4538

    Email:alice@tongpeptides.com

    Shop KPV5KPV10-Detailed Image 1 Shop KPV5KPV10-Detailed Image 2
    Name:Alice

    Whatsapp:+852 5513 4538

    Email:alice@tongpeptides.com


    Pinealon is a refined synthetic tripeptide consisting of three natural amino acids: glutamic acid, aspartic acid, and arginine, commonly recognized by its amino acid sequence code EDR. Rooted in decades of professional bioregulation research, this mild bioactive compound has become a widely studied substance in neural and cellular wellness research. With a compact molecular structure and stable properties, it stands out among bioregulatory peptides for its unique ability to support central nervous system balance and maintain long-term cellular wellness, making it popular for academic research and daily wellness conditioning exploration.​

    What distinguishes Pinealon from ordinary nutritional ingredients is its gentle biological regulation mechanism. Unlike fast-acting stimulative substances that bring temporary changes, Pinealon works at the cellular and genetic expression level. Its small molecular size allows it to penetrate cell structures smoothly and interact with gene regions related to cellular antioxidant defense, neuronal stability, and biological rhythm regulation. It does not interfere with the body’s normal physiological operations but assists the internal self-regulation system in maintaining balance, relieving accumulated oxidative pressure caused by daily fatigue, high mental load, and natural aging, and consolidating the stability of neural microenvironment.​

    In wellness research observations, Pinealon shows outstanding supportive value for cognitive and mental state maintenance. Modern life brings persistent mental fatigue, frequent concentration tasks, and chronic stress, which may gradually affect daily thinking clarity, attention stability, and memory performance. Long-term observational studies indicate that continuous and standardized exposure to Pinealon helps stabilize neural signal transmission, maintain active and efficient thinking status, and relieve persistent mental tiredness. It assists in balancing neural comfort, enabling individuals to maintain steady focus and agile thinking during long working and studying periods, and alleviates the low mood and mental sluggishness caused by prolonged stress accumulation.​

    Another core research direction of Pinealon is circadian rhythm and resting state conditioning. The pineal gland plays a key role in regulating the human body’s day-night biological clock and endogenous hormone balance. Daily screen exposure, irregular work schedules, and cross-timezone travel often disrupt the natural rhythm of the pineal gland, leading to unstable resting quality. Pinealon gently nurtures the physiological activity of the pineal gland, supports the body’s natural endogenous rhythm adjustment, and helps users achieve more continuous and comfortable rest states. Notably, this regulatory effect is gradual and mild, without causing drowsiness or physical dependence, and can effectively improve sub-health problems such as shallow rest and easy waking caused by rhythm disorder.​

    In terms of long-term cellular wellness maintenance, Pinealon delivers reliable antioxidant and neuroprotective support. Natural metabolism and external environmental stimulation will produce excess free radicals in the human body, which gradually wear nerve cells and affect neural activity stability over time. Research data shows that Pinealon can assist the body in scavenging excess oxidative metabolites, protect neuronal mitochondrial energy metabolism, maintain the integrity of neural cell structures, and slow down the sub-health decline of nervous system function caused by natural aging and long-term stress. It also helps maintain good synaptic activity, laying a solid foundation for long-term nervous system stability.​

    Pinealon features high biological compatibility and mild tolerance. As a research-grade bioregulator derived from natural amino acid combinations, it has extremely low irritability to the human body. Most observational data shows no obvious adverse reactions during standardized cyclic use. A small number of users may experience transient mild physical adaptation reactions in the initial stage, which will naturally disappear with physical adaptation. For daily wellness exploration, it is usually adopted in cyclic use mode. A reasonable intermittent cycle can maintain the body’s sensitive response to the peptide components and avoid physiological inertia, ensuring stable and lasting regulatory effects.​

    It is essential to clarify the compliant positioning of Pinealon. All related descriptions are summarized from public academic research and laboratory observational data, serving for scientific research and daily wellness conditioning reference only. Pinealon is not a medical product, nor can it replace professional medical diagnosis and treatment. It has not obtained therapeutic certification from mainstream global medical regulatory authorities, and no definite medical efficacy is claimed. Groups with special physical conditions, chronic physical discomfort, or those taking long-term regulated health products are advised to consult professional practitioners before use.​

    In conclusion, Pinealon is a valuable mild bioregulatory peptide. With its unique genetic regulation mechanism, stable antioxidant performance, and excellent neural and rhythmic conditioning attributes, it provides a safe and gradual wellness optimization option for modern people facing mental fatigue, rhythm disorder, and age-related sub-health changes. It focuses on activating the body’s inherent regulatory ability, helping the nervous system and biological rhythm maintain a healthy and balanced state, and has broad research and application prospects in the field of daily wellness maintenance.


      Shipping Method  Shop KPV5KPV10-Detailed Image 3 



    Shop KPV5KPV10-Detailed Image 4 Shop KPV5KPV10-Detailed Image 5 Shop KPV5KPV10-Detailed Image 6 Shop KPV5KPV10-Detailed Image 7
    Shop Samaglutide2mg,5mg,10mg,15mg,20mg,30mg-Detailed Image 11
    Shop KPV5KPV10-Detailed Image 9
    Shop Samaglutide2mg,5mg,10mg,15mg,20mg,30mg-Detailed Image 13
    Shop Samaglutide2mg,5mg,10mg,15mg,20mg,30mg-Detailed Image 14
    Shop Samaglutide2mg,5mg,10mg,15mg,20mg,30mg-Detailed Image 15
    Shop KPV5KPV10-Detailed Image 13 Shop KPV5KPV10-Detailed Image 14 Shop KPV5KPV10-Detailed Image 15 Shop KPV5KPV10-Detailed Image 16


    Introduction to Our Factory 


    We are a professional and reliable peptide manufacturing factory in China, focusing on the R&D, production and supply of high-purity research-grade peptides and biochemical raw materials. Adhering to strict production standards and complete quality control systems, we are committed to providing cost-effective, high-quality peptide products and stable global supply services for international customers.
    Quality is our core advantage. All our peptide products adopt advanced synthesis and purification technology, with universal HPLC purity over 99%. Every batch of goods undergoes strict laboratory testing, including high-performance liquid chromatography and mass spectrometry analysis. Complete test reports are provided to ensure stable ingredient content, low impurity rate and consistent product quality. All products are lyophilized and sealed in sterile independent vials to guarantee long-term stability during international transportation and storage.
    Compared with other suppliers in the industry, we offer obvious price advantages. With independent production bases, standardized assembly lines and integrated supply chain management, we effectively reduce intermediate costs. We provide factory-direct wholesale prices while maintaining top-tier purity and quality, helping customers maximize profit margins with high cost performance.
    Sufficient in-stock inventory covers mainstream peptide products, enabling rapid shipment within 1–3 working days after order confirmation. We have long-term cooperative professional freight teams, supporting stable and safe shipping to Europe, America, Southeast Asia, South America and other regions worldwide. With rich international export experience, our professional document sorting and standardized packaging greatly improve customs clearance pass rate, effectively avoiding customs detention risks and ensuring safe and smooth delivery of each order.
    We always insist on standardized export procedures, stable quality control, competitive factory prices and efficient after-sales service, aiming to become your most trustworthy long-term peptide supply partner. All products are for laboratory research use only, not for human clinical use. Shop KPV5KPV10-Detailed Image 17


         Q&A    


    Q1: Why should you buy from us instead of other suppliers?

    A1: Because we are a factory, we can provide lower prices and guaranteed quality. We have extensive experience in domestic and foreign trade and provide services in an honest, timely and efficient manner.

    Q2: When can I receive the package?

    A2: It will be shipped as soon as possible after payment, and the shipping time is generally 7 to 12 days.

    Q3: What is the minimum amount I can order?

    A3: The minimum quantity we can order is 1 box, which contains 10vials.Shop KPV5KPV10-Detailed Image 18 Shop KPV5KPV10-Detailed Image 19


    Items Specifications
    PI5

    5mg*10vials

    PI10

    10mg*10vials

    PI20 20mg*10vials

    Shop KPV5KPV10-Detailed Image 20 Shop KPV5KPV10-Detailed Image 21 Shop KPV5KPV10-Detailed Image 22

    ECHEMI Editorial Reference
    LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.
    Research & Reference Note

    Pinealon| TongPeptides | 99% Purity |PI5 is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals

    Certificates

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Polypeptide

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Manufactory

    Main Products:

    retatrutide,TB-500,GHK-CU,peptide

    Location:

    1-1, Kailuo Road, Taojia Town, Jiulongpo District, Chongqing

    Payment Terms:

    TT against copy of documents,L/C,TT against B/L draft before shipment,100% TT in advance

    Total Annual Revenue:

    $10 million-$25 million

    Total Employees:

    501-1000

    Year of Establishment:

    2023

    Pharma Grade Peptides is your premium source for high-quality purified research peptides.

    We have served over 20,000 customers on Alibaba and now offer the same quality at our independent store.

    Over the course of many years, we have empowered researchers and scientists to
    explore new avenues of scientific discovery.

  • Inquiry History
    3 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.