 Home > Biochemical Engineering > Polypeptide > LL-37 for Sale > Cagrilintide+semaglutide| TongPeptides | 99% Purity |CS20

Cagrilintide+semaglutide| TongPeptides | 99% Purity |CS20 buy - large image1

Cagrilintide+semaglutide| TongPeptides | 99% Purity |CS20 buy - image1

Cagrilintide+semaglutide| TongPeptides | 99% Purity |CS20 buy - image2

Cagrilintide+semaglutide| TongPeptides | 99% Purity |CS20 buy - image3

Cagrilintide+semaglutide| TongPeptides | 99% Purity |CS20 buy - image4

Cagrilintide+semaglutide| TongPeptides | 99% Purity |CS20

Name: Cagrilintide+semaglutide| TongPeptides | 99% Purity |CS20
Brand: Tongpeptide
SKU: pr2608131349
Price: 20 USD
Availability: InStock

TDS 3 Inquiries

Unit Price:

$20/UNIT FOB

Get Latest Price 

CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99.5%

Port:

china

Brand:

Tongpeptide

Packaging:

mg*10vials

Price valid (until):

2026-09-13

Contact Supplier

 Chat Now

Tong peptides

Company Type:

Manufactory

Location:

China

Qualification:

Main Products:

retatrutide,TB-500,GHK-CU,peptide

 Visit Store

Product Description
Seller Information
Inquiry History

Description

Descriptiopn

Name:Alice

Whatsapp:+852 5513 4538

Email:alice@tongpeptides.com

Name:Alice

Whatsapp:+852 5513 4538

Email:alice@tongpeptides.com

CS20 is a sophisticated synthetic bioactive peptide developed for targeted cellular and physiological wellness modulation, widely adopted in modern biochemical and sub-health conditioning research. Engineered with a precise amino acid sequence and optimized molecular stability, this research-grade peptide delivers high bioactivity and reliable biocompatibility within human physiological environments. Unlike common broad-spectrum nutritional regulators, CS20 features targeted pathway affinity, focusing on balancing core cellular signaling and antioxidant defense systems. Its refined structural design enables steady, gentle physiological adjustment, making it a promising subject for long-term wellness maintenance and cellular microenvironment optimization studies.

The primary characteristic of CS20 is its mild protective and regulatory mechanism at the cellular level. It gently modulates intracellular metabolic signaling pathways, helping stabilize cellular activity and alleviate cumulative oxidative stress triggered by daily environmental stimulation, mental fatigue, and natural physiological aging. Instead of generating abrupt metabolic changes, it reinforces the body’s inherent antioxidant defense capacity, reducing persistent cellular wear and maintaining stable tissue vitality. This gradual conditioning effectively improves sub-health states caused by long-term oxidative imbalance and sluggish cellular renewal.

Standardized laboratory observations confirm that cyclic exposure to CS20 supports comprehensive physiological stability and adaptive capacity. It assists in balancing regular metabolic rhythm, optimizing energy conversion efficiency, and relieving chronic physical pressure induced by sedentary lifestyles and irregular daily routines. Additionally, CS20 helps sustain steady neural and physical comfort, supporting consistent mental clarity and stable emotional status by maintaining balanced cellular microenvironment conditions. These layered supportive effects contribute to improved overall physical resilience and daily wellness vitality.

CS20 demonstrates a favorable safety and tolerance profile in public research datasets. Its peptide structure aligns naturally with human biochemical mechanisms, resulting in minimal adaptive reactions during initial use. Any transient mild physical adjustments typically subside naturally with continuous bodily adaptation. No physiological dependency or drastic metabolic fluctuation has been observed in standardized trials, supporting its suitability for long-term, mild wellness conditioning and daily sub-health improvement.

It is formally clarified that all statements are summarized from public academic research and laboratory observational data, intended solely for scientific study and wellness reference. CS20 is a professional research-grade peptide material, not a medical product or ordinary nutritional supplement. It does not provide therapeutic functions and cannot replace professional medical diagnosis, treatment, or guidance. Individuals with underlying health conditions or ongoing physical management plans should consult qualified healthcare practitioners before any exploratory application.

Shipping Method

Introduction to Our Factory

We are a professional and reliable peptide manufacturing factory in China, focusing on the R&D, production and supply of high-purity research-grade peptides and biochemical raw materials. Adhering to strict production standards and complete quality control systems, we are committed to providing cost-effective, high-quality peptide products and stable global supply services for international customers.

Quality is our core advantage. All our peptide products adopt advanced synthesis and purification technology, with universal HPLC purity over 99%. Every batch of goods undergoes strict laboratory testing, including high-performance liquid chromatography and mass spectrometry analysis. Complete test reports are provided to ensure stable ingredient content, low impurity rate and consistent product quality. All products are lyophilized and sealed in sterile independent vials to guarantee long-term stability during international transportation and storage.

Compared with other suppliers in the industry, we offer obvious price advantages. With independent production bases, standardized assembly lines and integrated supply chain management, we effectively reduce intermediate costs. We provide factory-direct wholesale prices while maintaining top-tier purity and quality, helping customers maximize profit margins with high cost performance.

Sufficient in-stock inventory covers mainstream peptide products, enabling rapid shipment within 1–3 working days after order confirmation. We have long-term cooperative professional freight teams, supporting stable and safe shipping to Europe, America, Southeast Asia, South America and other regions worldwide. With rich international export experience, our professional document sorting and standardized packaging greatly improve customs clearance pass rate, effectively avoiding customs detention risks and ensuring safe and smooth delivery of each order.

We always insist on standardized export procedures, stable quality control, competitive factory prices and efficient after-sales service, aiming to become your most trustworthy long-term peptide supply partner. All products are for laboratory research use only, not for human clinical use.

Q&A

Q1: Why should you buy from us instead of other suppliers?

A1: Because we are a factory, we can provide lower prices and guaranteed quality. We have extensive experience in domestic and foreign trade and provide services in an honest, timely and efficient manner.

Q2: When can I receive the package?

A2: It will be shipped as soon as possible after payment, and the shipping time is generally 7 to 12 days.

Q3: What is the minimum amount I can order?

A3: The minimum quantity we can order is 1 box, which contains 10vials.

Items Specifications

CS20
20mg*10vials

ECHEMI Editorial Reference

LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.

Certificates
- TDS
Basic Info

Product Name:
LL-37

Other Name:
Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

CAS No.:
154947-66-7

Molecular Formula:
C205H340N60O53

InChIKeys:
POIUWJQBRNEFGX-XAMSXPGMSA-N

Molecular Weight:
0

EC Number:
211-519-9

Color/Form:
White to off-white

Categories:
Polypeptide

Characteristics

Water Solubility:
Soluble to 1 mg/ml in water

Research

Class:
Amylin receptor (AMYR) / calcitonin receptor (CTR) agonist (long-acting amylin analog)

Status:
Investigational — Phase 3 (REDEFINE program, CagriSema combination)

Mechanism:
A novel long-acting, acylated amylin (islet amyloid polypeptide, IAPP) analog consisting of 38 amino acids. Cagrilintide activates the amylin receptor (AMYR) and calcitonin receptor (CTR), reducing food intake, delaying gastric emptying, and promoting satiety. Being developed as monotherapy and in fixed-dose combination with semaglutide (CagriSema) for obesity. Administered once weekly.

Activity note:
Cagrilintide is a non-selective AMYR/CTR agonist. Specific EC50 values not publicly available; functional potency is comparable to native amylin at AMYR.

Source:
MCE: Cagrilintide (CAS 1415456-99-3); Novo Nordisk REDEFINE program.

Clinical Development:
NCT05249895; NCT05249882

References

PubChem:
PubChem

Literature:
MCE: Cagrilintide (CAS 1415456-99-3); ClinicalTrials.gov: REDEFINE-1 (NCT05249895); Novo Nordisk: EASD 2025 Cagrilintide data presentation

Disclaimer:
Cagrilintide is NOT FDA-approved or EMA-approved. It is in Phase 3 clinical trials (REDEFINE program). This listing is for industrial and laboratory research use only. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.
Seller Information

Business Type:
Manufactory

Main Products:
retatrutide,TB-500,GHK-CU,peptide

Location:
1-1, Kailuo Road, Taojia Town, Jiulongpo District, Chongqing

Payment Terms:
TT against copy of documents,L/C,TT against B/L draft before shipment,100% TT in advance

Total Annual Revenue:
$10 million-$25 million

Total Employees:
501-1000

Year of Establishment:
2023

Pharma Grade Peptides is your premium source for high-quality purified research peptides.

We have served over 20,000 customers on Alibaba and now offer the same quality at our independent store.

Over the course of many years, we have empowered researchers and scientists to
explore new avenues of scientific discovery.

Inquiry History

3 Inquiries

Country	Product	Purchase Quantity	Date Posted
Indonesia	LL 37	1	Aug 6, 2026
Indonesia	LL 37	1	Aug 6, 2026
Indonesia	LL-37	5 MG	Jun 23, 2026

Post an enquiry for this product

More Choices Find All Products for Sale 

Product Name	Grade / Content	Price	Supplier Name	Details
LL37 10mg Vials Epitalon CAS 307297-39-8 Peptides Supply Ghk-Cu	Pharmaceutical Grade/99	$80/UNIT FOB	Haikou Mingheng	Inquiry
Peptide White Powder LL-37 99% Purity LL37 Antimicrobial Peptide CAS:154947-66-7	Pharmaceutical Grade/99	$100-130/UNIT FOB		Inquiry
Antibacterial Protein LL-37 (human)	Research and Industrial Grade/98.00		Hangzhou Go Top Peptide Biotech Co.,Ltd.	Inquiry
LL-37, LL37, CAMP, CAP-18, 154947-66-7	Reagent Grade/98	$400-500/G FOB	cellmano peptide	Inquiry
China origin Antimicrobial Peptide Cathelicidin LL-37 (Human) used to kill Gram-negative and Gram-positive bacteria, CAS#154947-66-7	Reagent Grade/98.0		DALIAN HANDOM CHEMICALS CO.,LTD.	Inquiry

Items	Specifications
CS20	*20mg10vials**

Cagrilintide+semaglutide| TongPeptides | 99% Purity |CS20

Product Description

Seller Information

Inquiry History

More Choices Find All Products for Sale 

Related Searches