Product
Supplier
Encyclopedia
Inquiry
Home > Biochemical Engineering > Polypeptide > LL-37 for Sale > NP810 High purity |Best quality, NP810 NP810 high-quality products| available in stock in the wareho
NP810 High purity |Best quality, NP810 NP810 high-quality products| available in stock in the wareho buy - large image1
NP810 High purity |Best quality, NP810 NP810 high-quality products| available in stock in the wareho buy - image1
NP810 High purity |Best quality, NP810 NP810 high-quality products| available in stock in the wareho buy - image2
NP810 High purity |Best quality, NP810 NP810 high-quality products| available in stock in the wareho buy - image3
NP810 High purity |Best quality, NP810 NP810 high-quality products| available in stock in the wareho buy - image4
NP810 High purity |Best quality, NP810 NP810 high-quality products| available in stock in the wareho buy - image5
NP810 High purity |Best quality, NP810 NP810 high-quality products| available in stock in the wareho buy - image6

NP810 High purity |Best quality, NP810 NP810 high-quality products| available in stock in the wareho

3 Inquiries

Unit Price:

$34/MT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

HongKong

Brand:

kangtai

Packaging:

10 bottles per box

Price valid (until):

2026-09-13

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Polypeptide

  • Product Description

  • Seller Information

  • Inquiry History

  • Description

      Description

                                                                       sales:senven Qin

                                                                 Whatsapp:+63 9360 463966

                                                                 Email:329379139@qq.com

                                 sincerely look forward to your inquiries about our products.

                                                                                           Product Detail  

    Made of premium raw materials with high purity and low impurity. It has stable physical properties and excellent water solubility. Rich in biological activity with mild and efficient effect, consistent batch quality and easy storage. Widely used in biological scientific research and related experiments with stable supply and reliable quality.

    Peptide products offer diverse functional benefits across multiple scenarios:

    in health management, peptides support metabolic regulation (aiding in blood sugar control and healthy weight management for specific groups) and immune system modulation by enhancing the body's defense responses; 

    in skincare, peptides promote skin barrier repair, boost collagen synthesis to reduce fine lines, and improve skin hydration and elasticity; 

    in sports nutrition, peptides assist in muscle recovery by reducing post-exercise tissue damage and supporting muscle protein synthesis.

    Shop NP810 High purity |Best quality, NP810 NP810 high-quality products| available in stock in the wareho-Detailed Image 1 Shop NP810 High purity |Best quality, NP810 NP810 high-quality products| available in stock in the wareho-Detailed Image 2 Shop NP810 High purity |Best quality, NP810 NP810 high-quality products| available in stock in the wareho-Detailed Image 3

    Items Specifications
    Product Name  np810
    CAS NO. 154947-66-7
    Packaging    10 bottles per box
    inimum order quantity     1 box(10vials)
    Price     $34
    Payment methods      Alibaba/Alipay/wise/USDT(Pay First, Ship Later)
    Shipping time     In the U.S., it takes 7 to 10 days; for other places, check the specific address.
    Storage Temperature     Store at -20°C for long term; 2-8°C for short term stability
    Grade     Pharmaceutical Grade
    Content     99%

    Shop NP810 High purity |Best quality, NP810 NP810 high-quality products| available in stock in the wareho-Detailed Image 4 Shop NP810 High purity |Best quality, NP810 NP810 high-quality products| available in stock in the wareho-Detailed Image 5 Shop NP810 High purity |Best quality, NP810 NP810 high-quality products| available in stock in the wareho-Detailed Image 6



                                                                                       About Us KANGTAI Company Profile

    Kangtai is a modern biopharmaceutical raw material enterprise with deep research and development, large-scale production and global supply of biopeptide raw materials. It has long focused on the whole industrial chain layout of functional peptides, medical active peptides and metabolic management peptide raw materials. It has independent peptide synthesis laboratory, standardized clean production workshop and complete three-level quality inspection center.
    The core team of our company is composed of professional and technical personnel of biochemistry, peptide synthesis and pharmaceutical preparations. We have accumulated rich practical experience in solid-phase synthesis, purification, freeze-drying and stable preparation development of long-chain peptides. We are proficient in the process optimization of GLP-1 / GIP target peptides, and can stably produce high-purity tierpo peptide and other weight-loss metabolic active peptide raw materials.
    The whole production process follows the ISO9001 quality management system and cGMP production specification, and establishes a full-link control standard from raw material storage, synthesis and purification, liquid phase quality inspection, aseptic freeze-drying to finished product packaging. It can provide standardized high-purity polypeptide raw materials, customized synthesis and technical formula matching one-stop service for domestic and foreign pharmaceutical research and development institutions, health preparation factories and biological research laboratories. The products are long-term supply to the domestic and foreign scientific research and preparation development market, and have been recognized by long-term cooperative customers with stable purity, batch consistency and perfect quality inspection report.

    Shop NP810 High purity |Best quality, NP810 NP810 high-quality products| available in stock in the wareho-Detailed Image 7 Shop NP810 High purity |Best quality, NP810 NP810 high-quality products| available in stock in the wareho-Detailed Image 8 Shop NP810 High purity |Best quality, NP810 NP810 high-quality products| available in stock in the wareho-Detailed Image 9

                                                                         Why did you choose us.

    We are a professional peptide supplier, offering four key advantages: high-purity products, efficient and safe global logistics, flexible and convenient payment methods, and a professional and dedicated team - all of which are designed to help your business reach a higher level.

    We work with many logistics companies around the world. Our global shipping network ensures that our safe and efficient logistics services can meet your urgent needs.


    Shop NP810 High purity |Best quality, NP810 NP810 high-quality products| available in stock in the wareho-Detailed Image 10

                                                                       Product superiority

    1.All peptides and raw materials have a purity of over 99%, and we provide numerous HPLC test reports (anoshik).

    2. 100% Safe Delivery
    3. The lowest price across the entire network, unparalleled!

    4.payment method: USDT/Wise/Alipay/Alibaba

    Shop NP810 High purity |Best quality, NP810 NP810 high-quality products| available in stock in the wareho-Detailed Image 11 Shop NP810 High purity |Best quality, NP810 NP810 high-quality products| available in stock in the wareho-Detailed Image 12

    ECHEMI Editorial Reference
    LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Polypeptide

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Polypeptide

    Location:

    Room 205-E742, Building F, No. 53 Congyun Road, Huangshi Street, Baiyun District, Guangzhou City

    Average lead Time:

    15

    Total Annual Revenue:

    Less than $1 million

    Total Employees:

    5-10

    Year of Establishment:

    2026

  • Inquiry History
    3 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.