Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > Glucagon for Sale > GND2 GND2 GND2 GND2 High Quality GND2 99% Purity Research Grade Peptide Lyophilized Powder 2mg/Vial. .
GND2 GND2 GND2 GND2 High Quality GND2 99% Purity Research Grade Peptide Lyophilized Powder 2mg/Vial. . buy - large image1
GND2 GND2 GND2 GND2 High Quality GND2 99% Purity Research Grade Peptide Lyophilized Powder 2mg/Vial. . buy - image1
GND2 GND2 GND2 GND2 High Quality GND2 99% Purity Research Grade Peptide Lyophilized Powder 2mg/Vial. . buy - image2
GND2 GND2 GND2 GND2 High Quality GND2 99% Purity Research Grade Peptide Lyophilized Powder 2mg/Vial. . buy - image3
GND2 GND2 GND2 GND2 High Quality GND2 99% Purity Research Grade Peptide Lyophilized Powder 2mg/Vial. . buy - image4
GND2 GND2 GND2 GND2 High Quality GND2 99% Purity Research Grade Peptide Lyophilized Powder 2mg/Vial. . buy - image5
GND2 GND2 GND2 GND2 High Quality GND2 99% Purity Research Grade Peptide Lyophilized Powder 2mg/Vial. . buy - image6

GND2 GND2 GND2 GND2 High Quality GND2 99% Purity Research Grade Peptide Lyophilized Powder 2mg/Vial. .

TDS 4 Inquiries

Unit Price:

$40/UNIT FOB

Get Latest Price
CAS No.:

16941-32-5

Grade:

Pharmaceutical Grade

Content:

99%

Port:

Hong Kong

Brand:

customizable

Packaging:

10vials/box

Price valid (until):

2027-12-31

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Tirzepatide,Retatrutide,Survodutide,GHK-CU,GLOW,KLOW

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


                                            mailbox:huangbobo33@outlook.com

                                                                                                                whatsapp:+852 9500 9381

                                                                                                                            telegram:@Jkhunag





      What is a peptide?  


    A peptide is a short-chain compound formed by the linkage of multiple amino acids through peptide bonds. It is the basic building block of proteins.
    In simple terms:
    Amino acid = building blocks
    Peptide = several building blocks put together
    Protein = a large structure formed by many building blocks
    Classification of Peptides
    Depending on the number of amino acids:
    Dipeptide: 2 amino acids
    Tripeptide: 3 amino acids
    Oligopeptide: 2 - 20 amino acids
    Polypeptide: more than 20 amino acids
    Protein: usually more than 50 amino acids


    Shop Peptide Mots-C CAS 1627580-64-6 Motsc Acetate Peptide Global shipping-Detailed Image 1

    ems Specifications
    Origin China
    Purity 5%-99%
    Appearance Powder
    Color White
    Package Drum, Plastic container, Vacuum Packed
    Shelf life 2 years
    Storage Cool Dry Place

    What are the functions of peptides?
    There are thousands of peptides naturally present in the human body, which function as "signal transmitters" to regulate bodily functions.
    Common functions include:
    Growth and Repair
    Promote Cell Regeneration
    Tissue Repair
    Collagen Production
    For example:

    GHK-Cu
    BPC-157
    Metabolic regulation
    Control blood sugar
    Regulate appetite
    Promote fat metabolism
    For example:

    Semaglutide
    Tirzepatide
    Retatrutide
    Anti-aging
    Delaying cellular aging
    Promoting DNA repair
    Improving skin condition
    For example:

    Epithalon
    Pinealon
    Cortagen
    Beauty and skincare
    Antioxidation
    Reduce fine lines
    Enhance skin elasticity
    For example:

    GHK-Cu (Blue Copper Peptide) Matrixyl


    Shop Peptide Mots-C CAS 1627580-64-6 Motsc Acetate Peptide Global shipping-Detailed Image 2 Shop Peptide Mots-C CAS 1627580-64-6 Motsc Acetate Peptide Global shipping-Detailed Image 3 Shop Peptide Mots-C CAS 1627580-64-6 Motsc Acetate Peptide Global shipping-Detailed Image 4 Shop Peptide Mots-C CAS 1627580-64-6 Motsc Acetate Peptide Global shipping-Detailed Image 5

    Why are peptides so popular?
    Compared with traditional medications:
    ✅ Highly targeted
    ✅ High biological activity
    ✅ Low dosage
    ✅ Similar to natural substances in the human body
    Therefore, it has been widely studied:
    Weight loss management
    Anti-aging
    Exercise recovery
    Skin care
    Metabolic health
    Scientific research

    Shop Peptide Mots-C CAS 1627580-64-6 Motsc Acetate Peptide Global shipping-Detailed Image 6 Shop Peptide Mots-C CAS 1627580-64-6 Motsc Acetate Peptide Global shipping-Detailed Image 7









    company profile   


    Company Profile of Guangzhou Henghuang Trading Co., Ltd.
    Guangzhou Henghuang Trading Co., Ltd. specializes in the field of bioactive peptides. It integrates the supply of high-end peptide raw materials, the output of freeze-dried powder products, and personalized customized production. Based in the Guangdong-Hong Kong-Macao Greater Bay Area, it strives to provide high-standard raw materials and OEM solutions for the beauty and health industries, and empowers brand long-term development with cutting-edge biotechnology.
    The company carefully selects high-quality peptide raw materials, covering a full range of categories such as cosmetic peptides and functional active peptides. The purity of the raw materials strictly complies with the advanced industry standards, and the molecular activity is stable, meeting the diverse needs of product development. The freeze-dried powder is processed through a low-temperature vacuum freeze-drying process, which locks the activity of effective substances to the greatest extent. The quality is stable and suitable for various application scenarios such as hospital-line skincare, daily care products, and health derivatives. We deeply integrate upstream supply chain resources and collaborate with standardized production workshops. We can undertake the full chain services of formula development, formulation blending, specification customization, and packaging outsourcing, flexibly matching batch purchases and niche exclusive customization to meet the differentiated layout of customers.
    The enterprise strictly adheres to strict quality control standards, conducting rigorous verification at every step, from raw material entry, sample testing to product delivery. It firmly maintains the quality bottom line of safety and compliance. With the business philosophy of "craftsmanship for the long term, creating win-win outcomes", it relies on a mature supply chain system and technical service capabilities, while also considering product quality, delivery efficiency and cost advantages.


    Shop Peptide Mots-C CAS 1627580-64-6 Motsc Acetate Peptide Global shipping-Detailed Image 8




    ProducTestingtion and 


    Shop Peptide Mots-C CAS 1627580-64-6 Motsc Acetate Peptide Global shipping-Detailed Image 9


    Shop Peptide Mots-C CAS 1627580-64-6 Motsc Acetate Peptide Global shipping-Detailed Image 10


    Shop Peptide Mots-C CAS 1627580-64-6 Motsc Acetate Peptide Global shipping-Detailed Image 11


    Shop Peptide Mots-C CAS 1627580-64-6 Motsc Acetate Peptide Global shipping-Detailed Image 12


    About Us   


    Why choose us? 1. We have a complete, stable and high-quality raw material supply chain, providing customers with high-quality products. 2. We have strict quality inspection procedures and professional certificate testing to ensure the quality level of the final products. 3. Our excellent sales team can provide customers with integrated and professional services. 4. We offer various OEM and ODM services to meet the different needs of different customers, with a low minimum order quantity. 5. Professional suppliers and manufacturers, an enterprise integrating production and sales, provides customers with one-stop services. Q&A
    1. Do you accept customization?
    Response: We can provide corresponding customized solutions based on the specific needs of our customers.
    2. Can you provide samples?
    Response: We can offer samples to our customers and send them to them via express delivery promptly.
    3. How is your production capacity? Can you meet the customers' demands in a timely manner? Regarding this, we can produce the products required by the customers on time and have sufficient production capacity.
    4. How long is your delivery cycle?
    For orders under 50 kilograms, they can be dispatched within 5 days. For orders over 50 kilograms, the corresponding time will be negotiated based on the weight of the products.
    5. What are your payment terms?
    Regarding payment: For amounts ≤ $1000, 100% payment is required in advance; for amounts ≥ $1000, 50% payment by wire transfer is required, and the remaining amount should be paid before shipment. Irrevocable sight letter of credit is applicable.
    6. Do you provide OEM or ODM services for the products?
    Yes, if needed, we can customize the products for you.
    7. How do you ensure that the goods provided meet the standards?
    All goods will be inspected before shipment. If the goods fail to meet our quality commitment, you can apply for a refund.
    8. How will you deliver the goods?
    Regarding: We have close cooperation with DHL, TNT, UPS, FEDEX, EMS, China Air Post. For container products, we can provide shipping services by sea. You can also choose your own freight forwarder. 


    Shop Peptide Mots-C CAS 1627580-64-6 Motsc Acetate Peptide Global shipping-Detailed Image 13 Shop Peptide Mots-C CAS 1627580-64-6 Motsc Acetate Peptide Global shipping-Detailed Image 14



    ECHEMI Editorial Reference
    White or almost white powderProduced by the α cells of the islands of Langerhans and also by the gastric mucosa. It is opposite in effect to insulin. It appears to be a straight-chain polypeptide with a molecular weight of approximately 3500. Small amounts have been detected in commproduced by recombinant DNA technology ismarketed by Novo Nordisk (glucagon [recombinant] hydrochloride,GlucaGen HypoKit, GlucaGen Diagnostic Kit)and by Eli Lilly (glucagon [recombinant] Emergency Kit). The hypergly
    Research & Reference Note

    GND2 GND2 GND2 GND2 High Quality GND2 99% Purity Research Grade Peptide Lyophilized Powder 2mg/Vial. . is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals

    Certificates
    • GND2 GND2 GND2 GND2 High Quality GND2 99% Purity Research Grade Peptide Lyophilized Powder 2mg/Vial. . Certificates 1 TDS

    Basic Info
    Product Name:

    Glucagon

    Other Name:

    GLUCAGON 1-37;GLUCAGON (1-37) (PORCINE);GLUCAGON 37;GLUCAGON ACETATE;HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA;H-HIS-SER-GLN-GLY-THR-PHE-THR-SER-ASP-TYR-SER-LYS-TYR-LEU-ASP-SER-ARG-ARG-ALA-GLN-ASP-PHE-VAL-GLN-TRP-LEU-MET-ASN-THR-LYS-ARG-ASN-LYS-ASN-ASN-ILE-ALA-OH;OXYNTOMODULIN (PORCINE);OXYNTOMODULIN

    CAS No.:

    16941-32-5

    Molecular Formula:

    C153H225N43O49S

    InChIKeys:

    MASNOZXLGMXCHN-ZLPAWPGGSA-N

    Molecular Weight:

    3482.75

    Exact Mass:

    3480.615723

    EC Number:

    232-708-2

    HScode:

    2937190000

    Characteristics
    PSA:

    1564.04000

    XLogP3:

    -6.01

    Appearance:

    powder

    Density:

    1.53±0.1 g/cm3(Predicted)

    Refractive Index:

    1.682

    Water Solubility:

    Practically insoluble in water and in most organic solvents. It is soluble in dilute mineral acids and in dilute solutions of alkali hydroxides.

    Storage Conditions:

    −20°C

    Hazard Identification

    Classification of the substance or mixture

    Skin sensitization, Category 1

    Acute toxicity - Category 4, Inhalation

    Respiratory sensitization, Category 1

    GHS label elements, including precautionary statements

    Pictogram(s)
    Signal word

    Danger

    Hazard statement(s)

    H317 May cause an allergic skin reaction

    H332 Harmful if inhaled

    H334 May cause allergy or asthma symptoms or breathing difficulties if inhaled

    Precautionary statement(s)
    Prevention

    P261 Avoid breathing dust/fume/gas/mist/vapours/spray.

    P272 Contaminated work clothing should not be allowed out of the workplace.

    P280 Wear protective gloves/protective clothing/eye protection/face protection/hearing protection/...

    P271 Use only outdoors or in a well-ventilated area.

    P284 [In case of inadequate ventilation] wear respiratory protection.

    Response

    P302+P352 IF ON SKIN: Wash with plenty of water/...

    P333+P317 If skin irritation or rash occurs: Get medical help.

    P321 Specific treatment (see ... on this label).

    P362+P364 Take off contaminated clothing and wash it before reuse.

    P304+P340 IF INHALED: Remove person to fresh air and keep comfortable for breathing.

    P317 Get medical help.

    P342+P316 If experiencing respiratory symptoms: Get emergency medical help immediately.

    Storage

    none

    Disposal

    P501 Dispose of contents/container to an appropriate treatment and disposal facility in accordance with applicable laws and regulations, and product characteristics at time of disposal.

    Other hazards which do not result in classification

    no data available

    Handling and Storage

    Precautions for safe handling

    Handling in a well ventilated place. Wear suitable protective clothing. Avoid contact with skin and eyes. Avoid formation of dust and aerosols. Use non-sparking tools. Prevent fire caused by electrostatic discharge steam.

    Conditions for safe storage, including any incompatibilities

    Store the container tightly closed in a dry, cool and well-ventilated place. Store apart from foodstuff containers or incompatible materials.

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Tirzepatide,Retatrutide,Survodutide,GHK-CU,GLOW,KLOW

    Location:

    Building 1, Floor 2, No. 96 Banhe Road, Huangpu District, Guangzhou City, Room 2164

    Payment Terms:

    TT against copy of documents,D/P,L/C,D/A,O/A,TT against B/L draft before shipment,100% TT in advance

    Average lead Time:

    12

    Total Annual Revenue:

    $1 million-$2.5 million

    Total Employees:

    11-50

    Year of Establishment:

    2026

    Certifications:

    COA,COA,COA,COA,COA,COA,COA,COA,COA

    Company Profile of Guangzhou Henghuang Trading Co., Ltd.
    Guangzhou Henghuang Trading Co., Ltd. specializes in the field of bioactive peptides. It integrates the supply of high-end peptide raw materials, the output of freeze-dried powder products, and personalized customized production. Based in the Guangdong-Hong Kong-Macao Greater Bay Area, it strives to provide high-standard raw materials and OEM solutions for the beauty and health industries, and empowers brand long-term development with cutting-edge biotechnology.
    The company strictly selects high-quality peptide raw materials, covering a full range of categories such as cosmetic peptides and functional active peptides. The purity of the raw materials strictly complies with the advanced industry standards, and the molecular activity is stable, meeting the diverse needs of product development. The freeze-dried powder is processed through a low-temperature vacuum freeze-drying process, which locks the activity of effective substances to the greatest extent. The quality is stable and suitable for various application scenarios such as hospital-line skincare, daily care products, and health derivatives. We deeply integrate upstream supply chain resources and collaborate with standardized production workshops. We can undertake the full chain services of formula development, formulation blending, specification customization, and packaging outsourcing, flexibly matching batch purchases and niche exclusive customization to meet the differentiated layout of customers.
    The enterprise strictly adheres to strict quality control standards, conducting rigorous verification at every step, from raw material entry, sample testing to product delivery. It firmly maintains the quality bottom line of safety and compliance. With the business philosophy of "craftsmanship for the long term, creating win-win outcomes", it relies on a mature supply chain system and technical service capabilities, while also considering product quality, delivery efficiency and cost advantages.
    Focusing on the market, Henghuang Trading adheres to a high-end positioning, deeply delving into the peptide raw materials and freeze-dried powder sectors, and continuously iterating the raw material categories and production processes. With stable supply, flexible customization, and professional technical support, it serves overseas and domestic cooperative merchants, collaborates with partners to deeply explore the efficacy market, builds a high-quality peptide industry ecosystem, and creates a reliable raw material and customization service provider in the industry.

    ">
  • Inquiry History
    4 Inquiries
    Country Product Purchase Quantity Date Posted
    Belgium

    Glucagon 16941-32-5 Pharmaceutical grade

    10 PCS Jan 8, 2026
    Belgium

    Glucagon (1-29)

    5 MG Jan 9, 2026
    Netherlands

    glucagon

    1000 KG Feb 15, 2024
    Bulgaria

    Glucagon, not retatrutide, just glucagon

    1 G May 10, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.