Product
Supplier
Encyclopedia
Inquiry
Home > Active Pharmaceutical Ingredients > Other Chemical Drugs > LL-37 for Sale > RA10 Limited-time special offer, better for first-time buyers. Welcome to inquire.
RA10 Limited-time special offer, better for first-time buyers. Welcome to inquire. buy - large image1
RA10 Limited-time special offer, better for first-time buyers. Welcome to inquire. buy - image1
RA10 Limited-time special offer, better for first-time buyers. Welcome to inquire. buy - image2
RA10 Limited-time special offer, better for first-time buyers. Welcome to inquire. buy - image3
RA10 Limited-time special offer, better for first-time buyers. Welcome to inquire. buy - image4
RA10 Limited-time special offer, better for first-time buyers. Welcome to inquire. buy - image5
RA10 Limited-time special offer, better for first-time buyers. Welcome to inquire. buy - image6

RA10 Limited-time special offer, better for first-time buyers. Welcome to inquire.

TDS 3 Inquiries

Unit Price:

$1/MT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99.9%

Port:

SHEN ZHEN

Brand:

customization

Packaging:

10 pieces per box

Price valid (until):

2027-08-24

Company Type:
Trader
Location:
Hongkong, China
Qualification:
Main Products:

polypeptide,GHK-CU,NAD+,Tirzepatide,GLutathione

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


    Whatsapp:+85265524367

    II. Dual-pathway Core Fat Loss, Prioritizing Internal Fat Elimination (Main Function)
    GLP-1 receptor pathway (Control Intake)
    It acts on the satiety center in the hypothalamus, prolonging post-meal satiety and inhibiting hunger signals, actively reducing the craving for high-calorie and sweet foods; it slows down the gastric emptying rate, naturally reducing total food intake.
    Glucose-dependent insulin secretion, only releasing insulin when blood sugar rises, significantly reducing the risk of hypoglycemia; simultaneously inhibiting endogenous glucagon, stabilizing the daily blood sugar fluctuations.
    GCGR glucagon receptor pathway (Increase Consumption, Burn Internal Fat, Unique Advantage)
    It directly activates liver fatty acid β-oxidation, forcing the decomposition of accumulated internal fat and liver fat. The Phase III clinical trial has confirmed that the maximum reduction of internal fat is 34%, while 89% of fat consumption occurs during weight loss, and only 10.8% is lost as lean muscle, making fat loss less prone to sagging and not losing muscle.
    It enhances the body's heat production and resting energy consumption, not relying on exercise to continuously burn fat, improving prolonged sitting with low metabolism, abdominal obesity, soft abdomen, and accumulation of fat masses in the lower limbs.
    It inhibits the differentiation of fat precursor cells, reducing the generation of new fat cells from the source, improving the tendency to gain weight due to high sugar and high-fat diet.
    II. Targeted Repair of Metabolic Fatty Liver (MASH/MASLD), Reversing Liver Fibrosis
    It directly acts on liver cells, reducing the deposition of triglycerides and cholesterol synthesis, eliminating the accumulation of fat in the liver, improving non-alcoholic fatty liver disease.
    It down-regulates the pro-inflammatory factors TNF-α and IL-6 in the liver, alleviating chronic inflammatory damage to the liver; blocking the fibrosis signaling pathway, 83% of patients achieved remission of fatty liver disease in the Phase II clinical trial, significantly improving mild to moderate liver fibrosis (F1-F3 stages).
    It reduces the burden of metabolic toxins in the liver, improving morning dizziness, body heaviness, and facial swelling after waking up caused by staying up late, excessive drinking, and high-fat diet.
    III. Improve Insulin Resistance, Stabilize Blood Sugar, Prevent Type 2 Diabetes
    It enhances the glucose uptake efficiency of muscles, fats, and liver cells, lowering the peak of post-meal blood sugar, reducing the fatigue, irritability, and persistent hunger caused by the roller-coaster of blood sugar.
    It reverses the hyperinsulinemia induced by obesity, reducing the efficiency of sugar conversion to fat, suitable for long-term regulation of people with abnormal glucose tolerance, abdominal obesity combined with high blood sugar.
    It reduces the low-level inflammation caused by high sugar toxicity throughout the body, alleviating joint soreness, skin dullness, and acne caused by inflammation.
    IV. Cardiovascular Multiple Protection, Optimizing Lipid Levels, Nurturing Vascular Endothelium
    It reduces blood triglycerides and low-density lipoprotein, reducing lipid oxidation deposition on the inner wall of blood vessels, delaying the process of vascular hardening.
    It repairs the vascular endothelial cells throughout the body, maintaining vascular elasticity, improving poor peripheral circulation, cold hands and feet, and dizziness due to prolonged sitting.
    It alleviates the burden on the heart caused by obesity, reducing the risk of metabolic-related hypertension, hyperlipidemia, and coronary heart disease.
    V. Improve Exercise Endurance, Accelerate Recovery After Exercise
    It increases the proportion of fat energy supply during exercise, delays fatigue from strength and aerobic training, prolongs the duration of exercise; improves weakness, shortness of breath during movement.
    It accelerates the elimination of lactate and fat metabolic waste, reduces delayed muscle soreness after training, shortens the overall repair cycle.
    During the fat loss period, it strongly inhibits cortisol-mediated muscle breakdown, maximizing the retention of lean body mass, maintaining a firm body shape, and avoiding the aggravation of orange peel-like texture.
    VI. Systemic Anti-Inflammation, Antioxidation, Delay Inflammatory Aging
    It systematically reduces chronic pro-inflammatory factors in adipose tissue, liver, and blood vessels, improving the chronic low-level inflammation caused by obesity and aging, alleviating morning stiffness, multiple migratory soreness.
    It reduces free radical oxidative damage, slows down the aging speed of internal organs and skin, and improves the dull complexion, sagging, and premature aging caused by long-term obesity.
    VII. Emotional and Sleep Regulation Assistance
    It balances the persistent high cortisol caused by high body fat, alleviates binge eating, stress-induced irritability, and depression. Reduce the pre-sleep excitement and disordered thoughts caused by metabolic disorders, enhance the body's repair efficiency during the night, and alleviate the symptoms of frequent dreams and remaining fatigue after waking up.

    Shop MT10-Detailed Image 1

    Shop MT10-Detailed Image 2 Shop MT10-Detailed Image 3

    Shop MT10-Detailed Image 4 Shop MT10-Detailed Image 5 Shop MT10-Detailed Image 6 Shop MT10-Detailed Image 7

    Shop MT10-Detailed Image 8 Shop MT10-Detailed Image 9

    Shop MT10-Detailed Image 10 Shop MT10-Detailed Image 11 Shop MT10-Detailed Image 12 Shop MT10-Detailed Image 13

    Hazard Identification

    Classification of the substance or mixture

    no data available

    GHS label elements, including precautionary statements

    Pictogram(s) no data available
    Signal word

    no data available

    Hazard statement(s)

    no data available

    Precautionary statement(s)
    Prevention

    no data available

    Response

    no data available

    Storage

    no data available

    Disposal

    no data available

    Other hazards which do not result in classification

    no data available

    Shop MT10-Detailed Image 14
    Handling and Storage

    Precautions for safe handling

    Handling in a well ventilated place. Wear suitable protective clothing. Avoid contact with skin and eyes. Avoid formation of dust and aerosols. Use non-sparking tools. Prevent fire caused by electrostatic discharge steam.

    Conditions for safe storage, including any incompatibilities

    Store the container tightly closed in a dry, cool and well-ventilated place. Store apart from foodstuff containers or incompatible materials.

    Items Specifications
    Product Name survotitude
    Purity 99.9%
    Storage Condition Seal and store in cool dry place
    ECHEMI Editorial Reference
    LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.

    Certificates
    • RA10 Limited-time special offer, better for first-time buyers. Welcome to inquire. Certificates 1 TDS

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Other Chemical Drugs

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    polypeptide,GHK-CU,NAD+,Tirzepatide,GLutathione

    Location:

    Room 5003, 5/F, Lee Yu Centre, 45 Hoi Yuen Road, Kwun Tong, Hong Kong

    Year of Establishment:

    2026

  • Inquiry History
    3 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.