Product
Supplier
Encyclopedia
Inquiry
Home > Biochemical Engineering > Polypeptide > LL-37 for Sale > MS10| TongPeptides | 99% Purity |COA
MS10| TongPeptides | 99% Purity |COA buy - large image1
MS10| TongPeptides | 99% Purity |COA buy - image1
MS10| TongPeptides | 99% Purity |COA buy - image2
MS10| TongPeptides | 99% Purity |COA buy - image3
MS10| TongPeptides | 99% Purity |COA buy - image4
MS10| TongPeptides | 99% Purity |COA buy - image5
MS10| TongPeptides | 99% Purity |COA buy - image6

MS10| TongPeptides | 99% Purity |COA

TDS 3 Inquiries

Unit Price:

$6/UNIT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99.5%

Port:

china

Brand:

Tongpeptide

Packaging:

mg*10vials

Price valid (until):

2026-09-18

Company Type:
Manufactory
Location:
China
Qualification:
Main Products:

retatrutide,TB-500,GHK-CU,peptide

  • Product Description

  • Seller Information

  • Inquiry History

  • Description

    Descriptiopn


    Name:Alice

    Whatsapp:+852 5513 4538

    Email:alice@tongpeptides.com

    Shop KPV5KPV10-Detailed Image 1 Shop KPV5KPV10-Detailed Image 2
    Name:Alice

    Whatsapp:+852 5513 4538

    Email:alice@tongpeptides.com


    MOTS‑c is a cutting‑edge mitochondrial‑derived bioactive peptide that has drawn widespread attention in biochemical research and high‑end skincare raw‑material industry. Produced through strictly controlled solid‑phase synthesis and multi‑stage lyophilization‑purification workflows, this premium raw material achieves high purity, stable peptide structure and reliable batch‑to‑batch consistency. The finished lyophilized powder features excellent solubility and gentle biological characteristics, showing great compatibility with most conventional cosmetic substrate systems, which makes it a favored active option for innovative formula development.
    The core functional value of MOTS‑c lies in its unique cellular‑level regulating properties. As a naturally inspired signaling peptide, it helps maintain balanced energy metabolism inside skin cells and supports the normal working state of mitochondria, the key energy‑supplying unit of cells. By easing excessive oxidative pressure and creating a more stable micro‑environment for cutaneous cells, this ingredient assists skin tissue in carrying out routine self‑maintenance processes. Different from many single‑function actives on the market, MOTS‑c works in a mild, long‑term conditioning way rather than bringing instant dramatic changes, helping to preserve the good condition and resilient texture of the skin over time.
    In practical formulation application, MOTS‑c can be flexibly added into serums, facial creams, essence liquids and other high‑value skincare products. Its low‑irritation profile allows formulators to develop gentle‑type anti‑fatigue and vitality‑boosting skincare solutions suitable for most skin types. Strict quality‑control standards are implemented throughout the whole production process, covering raw‑material screening, synthetic reaction monitoring, residual‑substance removal and finished‑product activity testing, to guarantee stable physical‑chemical properties and minimize formulation incompatibility risks.
    With consumers increasingly favoring science‑backed, multi‑dimensional skin‑care ingredients, MOTS‑c has become one of the most promising novel peptide raw‑materials. It offers cosmetic brand owners a brand‑new creative direction to build premium‑positioned skincare lines centered on cellular vitality maintenance, perfectly matching the global market trend of safe, mild and long‑term‑effective skincare products.


      Shipping Method  Shop KPV5KPV10-Detailed Image 3 



    Shop KPV5KPV10-Detailed Image 4 Shop KPV5KPV10-Detailed Image 5 Shop KPV5KPV10-Detailed Image 6 Shop KPV5KPV10-Detailed Image 7
    Shop Samaglutide2mg,5mg,10mg,15mg,20mg,30mg-Detailed Image 11
    Shop KPV5KPV10-Detailed Image 9
    Shop Samaglutide2mg,5mg,10mg,15mg,20mg,30mg-Detailed Image 13
    Shop Samaglutide2mg,5mg,10mg,15mg,20mg,30mg-Detailed Image 14
    Shop Samaglutide2mg,5mg,10mg,15mg,20mg,30mg-Detailed Image 15
    Shop KPV5KPV10-Detailed Image 13 Shop KPV5KPV10-Detailed Image 14 Shop KPV5KPV10-Detailed Image 15 Shop KPV5KPV10-Detailed Image 16


    Introduction to Our Factory 


    We are a professional and reliable peptide manufacturing factory in China, focusing on the R&D, production and supply of high-purity research-grade peptides and biochemical raw materials. Adhering to strict production standards and complete quality control systems, we are committed to providing cost-effective, high-quality peptide products and stable global supply services for international customers.
    Quality is our core advantage. All our peptide products adopt advanced synthesis and purification technology, with universal HPLC purity over 99%. Every batch of goods undergoes strict laboratory testing, including high-performance liquid chromatography and mass spectrometry analysis. Complete test reports are provided to ensure stable ingredient content, low impurity rate and consistent product quality. All products are lyophilized and sealed in sterile independent vials to guarantee long-term stability during international transportation and storage.
    Compared with other suppliers in the industry, we offer obvious price advantages. With independent production bases, standardized assembly lines and integrated supply chain management, we effectively reduce intermediate costs. We provide factory-direct wholesale prices while maintaining top-tier purity and quality, helping customers maximize profit margins with high cost performance.
    Sufficient in-stock inventory covers mainstream peptide products, enabling rapid shipment within 1–3 working days after order confirmation. We have long-term cooperative professional freight teams, supporting stable and safe shipping to Europe, America, Southeast Asia, South America and other regions worldwide. With rich international export experience, our professional document sorting and standardized packaging greatly improve customs clearance pass rate, effectively avoiding customs detention risks and ensuring safe and smooth delivery of each order.
    We always insist on standardized export procedures, stable quality control, competitive factory prices and efficient after-sales service, aiming to become your most trustworthy long-term peptide supply partner. All products are for laboratory research use only, not for human clinical use. Shop KPV5KPV10-Detailed Image 17


         Q&A    


    Q1: Why should you buy from us instead of other suppliers?

    A1: Because we are a factory, we can provide lower prices and guaranteed quality. We have extensive experience in domestic and foreign trade and provide services in an honest, timely and efficient manner.

    Q2: When can I receive the package?

    A2: It will be shipped as soon as possible after payment, and the shipping time is generally 7 to 12 days.

    Q3: What is the minimum amount I can order?

    A3: The minimum quantity we can order is 1 box, which contains 10vials.Shop KPV5KPV10-Detailed Image 18 Shop KPV5KPV10-Detailed Image 19


    Items Specifications
    MS10

    10mg *10vials

    MS40

     40mg *10vials



    Shop KPV5KPV10-Detailed Image 20 Shop KPV5KPV10-Detailed Image 21 Shop KPV5KPV10-Detailed Image 22

    ECHEMI Editorial Reference
    LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.
    Research & Reference Note

    MS10| TongPeptides | 99% Purity |COA is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals

    Certificates

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Polypeptide

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Manufactory

    Main Products:

    retatrutide,TB-500,GHK-CU,peptide

    Location:

    1-1, Kailuo Road, Taojia Town, Jiulongpo District, Chongqing

    Payment Terms:

    TT against copy of documents,L/C,TT against B/L draft before shipment,100% TT in advance

    Total Annual Revenue:

    $10 million-$25 million

    Total Employees:

    501-1000

    Year of Establishment:

    2023

    Pharma Grade Peptides is your premium source for high-quality purified research peptides.

    We have served over 20,000 customers on Alibaba and now offer the same quality at our independent store.

    Over the course of many years, we have empowered researchers and scientists to
    explore new avenues of scientific discovery.

  • Inquiry History
    3 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.