Product
Supplier
Encyclopedia
Inquiry
Home > Biochemical Engineering > Polypeptide > LL-37 for Sale > 154947-66-7LL37 | US Warehouse | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder
154947-66-7LL37 | US Warehouse | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder buy - large image1
154947-66-7LL37 | US Warehouse | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder buy - image1
154947-66-7LL37 | US Warehouse | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder buy - image2
154947-66-7LL37 | US Warehouse | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder buy - image3
154947-66-7LL37 | US Warehouse | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder buy - image4
154947-66-7LL37 | US Warehouse | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder buy - image5
154947-66-7LL37 | US Warehouse | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder buy - image6

154947-66-7LL37 | US Warehouse | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder

TDS 3 Inquiries

Unit Price:

$78/MT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

china

Brand:

any

Packaging:

5mg*10vials 10mg*10vials

Price valid (until):

2026-09-19

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Semag lutide,Tirzepatide,Retatrutide,raw material,GHK-CU,TB500(Thymosin B4 AceTate)

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


    i


    Appearance: White lyophilized solid powder
    Purity: ≥99.5% as determined by HPLC
    Product Grade: Standard laboratory research grade
    Solubility: Freely soluble in bacteriostatic water and purified water
    Product Brief Introduction belongs to the series of synthetic polypeptide raw materials and is widely used in fundamental research in modern laboratories. The product is produced via full chemical synthesis, followed by multi-stage purification and professional vacuum freeze-drying treatment. The finished powder features uniform texture without caking, stable physical properties and constant chemical composition.
    High-quality synthetic starting materials are adopted for production, and all processing procedures are completed in a standardized dust-free workshop. Unified operating specifications are implemented throughout the production process to effectively control batch variation and guarantee consistent quality across different batches. All finished products will undergo comprehensive testing at an independent third-party professional testing institution before shipment. Complete test files, authentic test data and standard analysis documents can be provided to facilitate daily laboratory data sorting and experimental reference.
    Core Product Advantages
    Adopted rigorous purification technology with low impurity content, suitable for high-precision laboratory experiments. Accurate filling quantity with sufficient active ingredients and stable component ratio. Mature vacuum freeze-drying technology effectively extends the stable storage period. Fast dissolution rate; the resulting solution is homogeneous without visible precipitates. Constant sufficient stock ensures stable supply capacity, supporting spot orders and bulk procurement. A comprehensive internal quality control system is established, and standard test documents are available for each batch. Diverse customization services are available, including label revision and outer carton style customization. Constant-temperature protective packaging is applied to maintain the inherent stability of materials during transportation.
    Testing Implementation Standard
    All testing items are carried out in accordance with internationally recognized testing standards for laboratory raw materials. Main testing indicators include core purity, residual moisture, foreign substance content and basic physical parameters. All test results comply with the general acceptance criteria for research raw materials. The 20mg specification products of this batch have passed all routine testing items with authentic and valid data, fully meeting the requirements of daily basic laboratory research, formula exploration and relevant academic research.
    Standard Storage Guidelines
    Long-term storage: Keep sealed at -20℃, avoid strong light and humid air. Short-term daily storage: Store in a sealed state under refrigeration. Storage after reconstitution: Keep the reconstituted solution refrigerated and use it up within 7 days. Repeated freeze-thaw cycles over a long period are prohibited to prevent damage to the inherent stability of raw materials.
    Solvent Preparation Guidelines
    Select suitable laboratory-specific solvents according to practical experimental plans. Add solvent slowly and dissolve with gentle shaking. Violent shaking of the solution is forbidden. Maintain a stable dissolution environment to preserve the original properties of the material. Prepare solutions at target concentrations for subsequent laboratory operations.
    Complete Packaging Specifications
    Single vial package: 20mg lyophilized raw material is sealed in a standard glass vial equipped with professional rubber stopper and aluminum crimp cap, together with an independent dust-proof and moisture-proof outer bag. Inner box package: 10 vials are packed in one fixed inner box with shockproof lining to prevent collision damage. Shipping outer carton: Thickened 5-layer export carton with overall sealing and reinforcement, delivering excellent moisture-proof, drop-proof and compression-resistant performance. All outer packaging complies with international general logistics standards. Clear marks of product specifications, storage reminders and fragile labels are printed on the outer package.
    Logistics & Cooperation Service
    Safe delivery is available to most regions worldwide. For such laboratory raw materials, we adopt dedicated temperature-controlled packaging solutions to ensure stable material status during long-distance transportation. Flexible order arrangement, prompt shipment and smooth follow-up order docking services are supported.
    General Usage Notice
    This product is only applicable to professional laboratory scientific research, academic project research and raw material formula development. It cannot be used for direct external application or any non-research purposes. Purchasers shall use this product in compliance with local relevant industry regulations and standard laboratory operating procedures.
    Main Application Fields
    It is applicable to basic research in biological laboratories, preliminary exploration of new raw materials, experimental research for academic institutions, data research of basic scientific projects and other formal research areas. It has gained consistent recognition among research institutions and research-related traders all over the world.
    Product Advantages
    Ultra-high purity with tested purity reaching 99.52%, low impurity level to reduce experimental interference factors. Precise net content with sufficient feeding volume; the actual active content exceeds the marked specification with stable effective components. Advanced freeze-drying technology extends the storage cycle and reduces the risk of deterioration and inactivation. Excellent solubility with rapid dissolution; the prepared solution is clear without precipitation. Abundant spot inventory guarantees stable supply, supporting wholesale and retail orders. Strict quality inspection system with complete test documents, facilitating customs clearance and business cooperation for customers. Customizable specifications, labels and private brand packaging services are available. Professional cold-chain packaging and transportation effectively prevent the loss of peptide activity caused by high temperature.
    Quality Inspection Standard
    We adopt internationally universal HPLC detection standards, strictly controlling product purity, moisture content, related substances, heavy metal content and microbial limits. All indicators meet international industry standards for research peptides. The 20mg finished products of this batch have passed all formal testing items with complete test data and authentic results, which can fully satisfy various academic research, laboratory tests, formula development and other scientific research demands.
    Storage Method
    Long-term storage: Seal and store at -20℃, protected from light and moisture. Short-term storage: Keep sealed at 2-8℃ in cool environment. After reconstitution: Store under refrigeration and consume within 7 days. Repeated freeze-thaw operations are strictly forbidden, as they may lead to decreased peptide activity and product failure.
    Reconstitution Suggestion
    Based on experimental requirements, select appropriate bacteriostatic water or sterile water for gentle dissolution. Shake slowly until fully dissolved. Avoid violent shaking to prevent damage to peptide activity. Prepare quantitative solutions at target concentrations for subsequent experimental operations.
    Packaging Specification
    Single unit package: 20mg lyophilized powder filled in standard medical glass vial, sealed with rubber stopper and aluminum cap, with independent moisture-proof package. Inner box: 10 vials per box with built-in shockproof foam to avoid collision and breakage. Export outer carton: Thickened 5-layer corrugated carton with reinforced sealing, moisture-proof, drop-proof and pressure-resistant. All export packaging meets international logistics standards, printed with clear shipping marks, product information, storage requirements and fragile signs.
    Logistics & Service
    Global safe transportation is supported. Professional low-temperature constant-temperature transportation solutions are adopted for peptide products to maintain stable activity during long-distance transit. Multiple payment methods are supported, with fast order scheduling, timely delivery and complete after-sales communication.
    Application Scope
    Widely applied in biological laboratory research, pharmaceutical raw material investigation, experimental research of university research institutions, new component development, scientific project tests and other professional research scenarios. It is highly trusted by research institutes, pharmaceutical R&D enterprises and scientific research traders across the globe.
    Keywords
    Shop 154947-66-7LL37 | US Warehouse | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder-Detailed Image 1
    Shop 154947-66-7LL37 | US Warehouse | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder-Detailed Image 2
    Shop 154947-66-7LL37 | US Warehouse | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder-Detailed Image 3
    Shop 154947-66-7LL37 | US Warehouse | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder-Detailed Image 4
    Shop 154947-66-7LL37 | US Warehouse | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder-Detailed Image 5
    Shop 154947-66-7LL37 | US Warehouse | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder-Detailed Image 6
    Shop 154947-66-7LL37 | US Warehouse | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder-Detailed Image 7
    Shop 154947-66-7LL37 | US Warehouse | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder-Detailed Image 8
    Shop 154947-66-7LL37 | US Warehouse | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder-Detailed Image 9
    Shop 154947-66-7LL37 | US Warehouse | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder-Detailed Image 10
    Shop 154947-66-7LL37 | US Warehouse | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder-Detailed Image 11
    Shop 154947-66-7LL37 | US Warehouse | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder-Detailed Image 12
    ECHEMI Editorial Reference
    LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.
    Research & Reference Note

    154947-66-7LL37 | US Warehouse | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals

    Certificates
    • 154947-66-7LL37 | US Warehouse | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder Certificates 1 TDS

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Polypeptide

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Semag lutide,Tirzepatide,Retatrutide,raw material,GHK-CU,TB500(Thymosin B4 AceTate)

    Location:

    Room 1002-C3973, No. 80, Yongtai Modaonan Street, Yongping Subdistrict, Baiyun District, Guangzhou City

    Payment Terms:

    TT against copy of documents,TT against B/L draft before shipment,100% TT in advance

    Average lead Time:

    45

    Year of Establishment:

    2026

    Anymang is a US-based trading company dedicated to the global supply and formulation of high-quality cosmetic raw materials, with a core focus on peptide ingredients. Committed to bridging premium suppliers and beauty manufacturers worldwide, we deliver pure, stable, and efficacious peptides—including anti-aging, brightening, and firming peptides—alongside a full spectrum of cosmetic actives and custom formulation solutions. With rigorous quality control and compliance with US safety standards, we ensure consistent batch quality and reliable delivery. Our experienced team provides professional technical support and tailored services to help clients develop competitive skincare and personal care products. Trusted by partners across the globe, Anymang stands as your dependable partner for innovative, high-performance cosmetic raw materials and peptide formulations.

  • Inquiry History
    3 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.