Product
Supplier
Encyclopedia
Inquiry
Home > Active Pharmaceutical Ingredients > Other Chemical Drugs > LL-37 for Sale > 98% Purity LL-37 Human Cathelicidin Antimicrobial Peptide Lyophilized Powder Bulk Factory Supply
98% Purity LL-37 Human Cathelicidin Antimicrobial Peptide Lyophilized Powder Bulk Factory Supply buy - large image1
98% Purity LL-37 Human Cathelicidin Antimicrobial Peptide Lyophilized Powder Bulk Factory Supply buy - image1
98% Purity LL-37 Human Cathelicidin Antimicrobial Peptide Lyophilized Powder Bulk Factory Supply buy - image2
98% Purity LL-37 Human Cathelicidin Antimicrobial Peptide Lyophilized Powder Bulk Factory Supply buy - image3
98% Purity LL-37 Human Cathelicidin Antimicrobial Peptide Lyophilized Powder Bulk Factory Supply buy - image4
98% Purity LL-37 Human Cathelicidin Antimicrobial Peptide Lyophilized Powder Bulk Factory Supply buy - image5
98% Purity LL-37 Human Cathelicidin Antimicrobial Peptide Lyophilized Powder Bulk Factory Supply buy - image6

98% Purity LL-37 Human Cathelicidin Antimicrobial Peptide Lyophilized Powder Bulk Factory Supply

TDS 3 Inquiries

Unit Price:

$54-61/UNIT EXW

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

ShenZhen

Brand:

XiWu

Packaging:

10mg/vial;10vials/box

Price valid (until):

2026-09-19

Company Type:
Trader
Location:
China
Qualification:
Main Products:

GLP-1,Retatrutide,Selank,Tirzepatide

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


    1. Contact Information

        If you have any demand or inquiry about peptide, please feel free to contact me. Wish you a nice day!

     

        WhatsApp: +852 6190 7366

    2. Product Introduction & Features

        LL-37 is the only human-derived cathelicidin cationic antimicrobial peptide, composed of 37 amino acids, cleaved from the C-terminal segment of precursor protein hCAP-18, presented as pure white sterile lyophilized powder. It features amphipathic α-helical structure, possesses broad-spectrum antibacterial, antifungal, antiviral, anti-biofilm activity, meanwhile exerts immunomodulation, endotoxin neutralization, angiogenesis promotion and skin tissue repair effects. Widely applied in innate immunity, microbial resistance, infectious inflammation and wound regeneration mechanism studies worldwide. Adopted solid-phase peptide synthesis and reversed-phase HPLC purification; each batch is verified by MALDI-TOF mass spectrometry, complete COA, HPLC chromatogram are provided.

    Shop 98% Purity LL-37 Human Cathelicidin Antimicrobial Peptide Lyophilized Powder Bulk Factory Supply-Detailed Image 1 Shop 98% Purity LL-37 Human Cathelicidin Antimicrobial Peptide Lyophilized Powder Bulk Factory Supply-Detailed Image 2
    Shop 98% Purity LL-37 Human Cathelicidin Antimicrobial Peptide Lyophilized Powder Bulk Factory Supply-Detailed Image 3

    Shop 98% Purity LL-37 Human Cathelicidin Antimicrobial Peptide Lyophilized Powder Bulk Factory Supply-Detailed Image 4
    Shop 98% Purity LL-37 Human Cathelicidin Antimicrobial Peptide Lyophilized Powder Bulk Factory Supply-Detailed Image 5

    3. Quality Inspection Standard

    1.     Every batch of Retatrutide peptide undergoes full-range testing in our in-house laboratory before shipment, with a corresponding COA (Certificate of Analysis) available for quality verification:
      1.     Purity: Tested via High Performance Liquid Chromatography (HPLC), the purity of finished powder reaches ≥99%. Detailed chromatogram data are documented in the COA certificate.
      2.     Appearance: Homogeneous white or off-white lyophilized solid powder, free of caking and visible foreign impurities.
      3.     Safety Tests: Every batch completes internal sterility test and bacterial endotoxin test. All qualified test data are fully listed in the attached COA report.
    2. Shop 98% Purity LL-37 Human Cathelicidin Antimicrobial Peptide Lyophilized Powder Bulk Factory Supply-Detailed Image 6
    4. Shipping Advantages & Payment Methods
        Global Cold Chain Transportation Advantages
        Offer global dedicated air cold chain transportation, maintaining product low temperature throughout the process and ensuring the activity of powders.
        Sealable packaging with leak-proof and shock-proof features: double-layer foam + refrigeration ice packs + outer box packaging, effectively preventing damage and powder leakage during transportation.
        Authorized cooperative logistics: FedEx, DHL global express, providing tracking numbers after shipment.
        Professional customs declaration document support: providing commercial invoices, packing lists, ensuring smooth customs clearance in the United States, the European Union, Canada, Australia, and Southeast Asia regions.
        Fast delivery cycle: Door-to-door delivery completed within 7-15 working days after shipment, including customs clearance time.
    Shop 98% Purity LL-37 Human Cathelicidin Antimicrobial Peptide Lyophilized Powder Bulk Factory Supply-Detailed Image 7
        Multiple payment options available (all stable and secure)

        Online quick checkout: PayPal, T/T Bank Transfer, International Wire Remittance

        After-sales service guarantee

        If the product quality does not meet the COA standards, we provide full refund service

        If goods get damaged during transit, free reshipping service is available. Our professional technical team offers free reconstitution and storage guidance for all clients.
    Shop 98% Purity LL-37 Human Cathelicidin Antimicrobial Peptide Lyophilized Powder Bulk Factory Supply-Detailed Image 8


    Items Specifications
    Product Name LL-37
    Purity ≥99%
    Storage After reconstitution store at 2°C - 8°C, well-closed containers
    Appearance White Lyophilized Powder

    5.Company Profile

        XiWu Technology Co., Ltd. is a professional GMP-grade manufacturer & supplier of research-grade peptide raw materials with independent production workshop and laboratory.
    We focus on high purity lyophilized peptides including Retatrutide, Semaglutide, Tirzepatide and other triple agonist peptides. All products are produced under strict cGMP standards, every production batch implements full-process quality inspection.
        We support small trial order and large bulk wholesale, provide global cold chain air shipping service and multiple safe payment methods. With stable production capacity, competitive factory direct price and 24-hour professional after-sales service, we have long-term stable cooperation with biochemical laboratories, research institutes and peptide distributors all over the world.
        Our factory owns automated filling production line, sterile purification workshop, independent quality inspection lab, complete set of testing equipment to control every production link strictly, guarantee stable and consistent product quality for all global partners. 

    Shop 98% Purity LL-37 Human Cathelicidin Antimicrobial Peptide Lyophilized Powder Bulk Factory Supply-Detailed Image 9

    Shop 98% Purity LL-37 Human Cathelicidin Antimicrobial Peptide Lyophilized Powder Bulk Factory Supply-Detailed Image 10

    Q1: What's your MOQ?

    A:For the regular produced products, our MOQ is 1box, for other customized products, our MOQ starts from 10boxes to 50boxes.

    Q2: How to confirm the product quality before placing the order?

    A:We have inspection report.

    Q3: Which kind of payment terms do you accept??

    A: Paypal, T/T ,BTC,USDT etc.

    Q4:How long will the transportation take?

    It usually takes around 7 to 15 days, including the time for customs clearance of the goods.

    Q5:How should I store the lyophilized Retatrutide powder to keep activity?

    Unopened original vials need to be stored under sealed cold environment at 2℃-8℃, avoid high temperature and direct sunlight; After reconstituted with sterile water, seal and store in refrigerator and finish use within 7 days.

    ECHEMI Editorial Reference
    LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.
    Research & Reference Note

    98% Purity LL-37 Human Cathelicidin Antimicrobial Peptide Lyophilized Powder Bulk Factory Supply is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals

    Certificates

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Other Chemical Drugs

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    GLP-1,Retatrutide,Selank,Tirzepatide

    Location:

    Room 307, No. 3, Building 7, Area 4, Pingchou, Jiangdong Street, Yiwu City, Jinhua City, Zhejiang Province

    Payment Terms:

    TT against copy of documents,100% TT in advance

    Average lead Time:

    1

    Total Annual Revenue:

    Less than $1 million

    Total Employees:

    11-50

    Year of Establishment:

    2026

  • Inquiry History
    3 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.