Product
Supplier
Encyclopedia
Inquiry
Home > Biochemical Engineering > Polypeptide > LL-37 for Sale > BB10| TongPeptides | 99% Purity |.
BB10| TongPeptides | 99% Purity |. buy - large image1
BB10| TongPeptides | 99% Purity |. buy - image1
BB10| TongPeptides | 99% Purity |. buy - image2
BB10| TongPeptides | 99% Purity |. buy - image3
BB10| TongPeptides | 99% Purity |. buy - image4
BB10| TongPeptides | 99% Purity |. buy - image5
BB10| TongPeptides | 99% Purity |. buy - image6

BB10| TongPeptides | 99% Purity |.

TDS 3 Inquiries

Unit Price:

$8/UNIT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99.5%

Port:

CHINA

Brand:

Tongpeptide

Packaging:

mg*10vials

Price valid (until):

2026-09-21

Company Type:
Manufactory
Location:
China
Qualification:
Main Products:

retatrutide,TB-500,GHK-CU,peptide

  • Product Description

  • Seller Information

  • Inquiry History

  • Description

    Descriptiopn


    Name:Alice

    Whatsapp:+852 5513 4538

    Email:alice@tongpeptides.com

    Shop KPV5KPV10-Detailed Image 1 Shop KPV5KPV10-Detailed Image 2
    Name:Alice

    Whatsapp:+852 5513 4538

    Email:alice@tongpeptides.com


     

    BB10 is a newly optimized synthetic peptide reagent designed for high-precision biochemical analysis and pre-clinical mechanism research. Adopting advanced solid-phase synthesis and fine purification techniques, this compound is engineered with a unique molecular structure, delivering superior biological stability, high target specificity and favorable solubility characteristics. As an innovative research material, BB10 has gained increasing attention in global biochemical laboratories for the study of endogenous signal regulation and physiological balance mechanisms.​

    Compared with traditional peptide research reagents, BB10 exhibits distinct advantages in targeted pathway regulation. It can effectively mimic key active substances in biological systems, participating in the regulation of cellular signal transmission and physiological metabolic processes. The reagent stably interacts with specific biological targets, helping researchers explore the underlying mechanisms of physiological state maintenance, metabolic adjustment and cellular functional activity. Multiple laboratory tests have proven that BB10 possesses excellent biocompatibility and stable experimental performance, providing a reliable new option for in vitro mechanism research, compound synergistic exploration and biochemical pathway verification.​

    Professional low-temperature storage and sealed cold-chain transportation are recommended to maintain the long-term biological activity of BB10. In line with industry specifications, this product is only used for scientific research and academic experimental purposes. It is not suitable for clinical application, human and animal in vivo use, nor can it be used in the production of food, drugs and cosmetics. We support customizable product specifications, long-term stable supply and global logistics services, with professional technical teams providing one-stop after-sales support to meet the diverse research needs of enterprises and research institutions worldwide.

     


      Shipping Method  Shop KPV5KPV10-Detailed Image 3 



    Shop KPV5KPV10-Detailed Image 4 Shop KPV5KPV10-Detailed Image 5 Shop KPV5KPV10-Detailed Image 6 Shop KPV5KPV10-Detailed Image 7
    Shop Samaglutide2mg,5mg,10mg,15mg,20mg,30mg-Detailed Image 11
    Shop KPV5KPV10-Detailed Image 9
    Shop Samaglutide2mg,5mg,10mg,15mg,20mg,30mg-Detailed Image 13
    Shop Samaglutide2mg,5mg,10mg,15mg,20mg,30mg-Detailed Image 14
    Shop Samaglutide2mg,5mg,10mg,15mg,20mg,30mg-Detailed Image 15
    Shop KPV5KPV10-Detailed Image 13 Shop KPV5KPV10-Detailed Image 14 Shop KPV5KPV10-Detailed Image 15 Shop KPV5KPV10-Detailed Image 16


    Introduction to Our Factory 


    We are a professional and reliable peptide manufacturing factory in China, focusing on the R&D, production and supply of high-purity research-grade peptides and biochemical raw materials. Adhering to strict production standards and complete quality control systems, we are committed to providing cost-effective, high-quality peptide products and stable global supply services for international customers.
    Quality is our core advantage. All our peptide products adopt advanced synthesis and purification technology, with universal HPLC purity over 99%. Every batch of goods undergoes strict laboratory testing, including high-performance liquid chromatography and mass spectrometry analysis. Complete test reports are provided to ensure stable ingredient content, low impurity rate and consistent product quality. All products are lyophilized and sealed in sterile independent vials to guarantee long-term stability during international transportation and storage.
    Compared with other suppliers in the industry, we offer obvious price advantages. With independent production bases, standardized assembly lines and integrated supply chain management, we effectively reduce intermediate costs. We provide factory-direct wholesale prices while maintaining top-tier purity and quality, helping customers maximize profit margins with high cost performance.
    Sufficient in-stock inventory covers mainstream peptide products, enabling rapid shipment within 1–3 working days after order confirmation. We have long-term cooperative professional freight teams, supporting stable and safe shipping to Europe, America, Southeast Asia, South America and other regions worldwide. With rich international export experience, our professional document sorting and standardized packaging greatly improve customs clearance pass rate, effectively avoiding customs detention risks and ensuring safe and smooth delivery of each order.
    We always insist on standardized export procedures, stable quality control, competitive factory prices and efficient after-sales service, aiming to become your most trustworthy long-term peptide supply partner. All products are for laboratory research use only, not for human clinical use. Shop KPV5KPV10-Detailed Image 17


         Q&A    


    Q1: Why should you buy from us instead of other suppliers?

    A1: Because we are a factory, we can provide lower prices and guaranteed quality. We have extensive experience in domestic and foreign trade and provide services in an honest, timely and efficient manner.

    Q2: When can I receive the package?

    A2: It will be shipped as soon as possible after payment, and the shipping time is generally 7 to 12 days.

    Q3: What is the minimum amount I can order?

    A3: The minimum quantity we can order is 1 box, which contains 10vials.Shop KPV5KPV10-Detailed Image 18 Shop KPV5KPV10-Detailed Image 19


    Items Specifications
    BB10

    10mg*10vials

    BB20

    20mg*10vials



    Shop KPV5KPV10-Detailed Image 20 Shop KPV5KPV10-Detailed Image 21 Shop KPV5KPV10-Detailed Image 22

    Classification of the substance or mixture

    Reproductive toxicity, Category 2

    GHS label elements, including precautionary statements

    Pictogram(s) Shop BB10| TongPeptides | 99% Purity |.-Detailed Image 23
    Signal word

    Warning

    Hazard statement(s)

    H361 Suspected of damaging fertility or the unborn child

    Precautionary statement(s)
    Prevention

    P203 Obtain, read and follow all safety instructions before use.

    P280 Wear protective gloves/protective clothing/eye protection/face protection/hearing protection/...

    Response

    P318 IF exposed or concerned, get medical advice.

    Storage

    P405 Store locked up.

    Disposal

    P501 Dispose of contents/container to an appropriate treatment and disposal facility in accordance with applicable laws and regulations, and product characteristics at time of disposal.

    Other hazards which do not result in classification

    ECHEMI Editorial Reference
    LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.
    Research & Reference Note

    BB10| TongPeptides | 99% Purity |. is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals

    Certificates

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Polypeptide

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Manufactory

    Main Products:

    retatrutide,TB-500,GHK-CU,peptide

    Location:

    1-1, Kailuo Road, Taojia Town, Jiulongpo District, Chongqing

    Payment Terms:

    TT against copy of documents,L/C,TT against B/L draft before shipment,100% TT in advance

    Total Annual Revenue:

    $10 million-$25 million

    Total Employees:

    501-1000

    Year of Establishment:

    2023

    Pharma Grade Peptides is your premium source for high-quality purified research peptides.

    We have served over 20,000 customers on Alibaba and now offer the same quality at our independent store.

    Over the course of many years, we have empowered researchers and scientists to
    explore new avenues of scientific discovery.

  • Inquiry History
    3 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.