Qualified LL-37 Antimicrobial Research Peptide Powder Suitable for Immunity Lab Tests

Whatsapp:+85244697127

                   +85297498756

If you are interested, please feel free to contact me at any time.

Product Introduction

LL‑37, also known as human cathelicidin peptide, is a synthetic 37‑amino‑acid host‑defense antimicrobial peptide derived from hCAP‑18 precursor protein. It is supplied as high‑purity white to off‑white lyophilized powder for laboratory research. This research material is widely adopted for in‑vitro experiments focusing on innate immunity, antimicrobial mechanism, inflammatory response and cell‑related biological pathway exploration. Each production batch undergoes HPLC and MS quality verification, and COA documents can be provided upon request for lab evaluation.

Mechanism of Action

LL‑37 interacts with negatively charged microbial membrane structures under experimental conditions. It participates in multiple immune‑related signal transduction pathways in pre‑clinical test models. Laboratory studies focus on observing its biological influences on pathogen membrane activity, immune cell chemotaxis and inflammatory‑related cell populations within in‑vitro assay systems.

Chemical Information

• Common Name: LL‑37
• Synonym: Human Cathelicidin Peptide
• CAS No.: 154947‑66‑7
• Sequence: [LL-37, 37 aa]
• Appearance: White‑off‑white lyophilized powder
• Purity: HPLC ≥98%
• Storage: Long‑term store at ‑20℃, avoid repeated freeze‑thaw cycles

Storage Condition

Store lyophilized LL‑37 powder under ‑20 ℃ dry and dark environment. After reconstitution, keep solution at 2‑8 ℃ and finish laboratory testing within short period. Keep away from high temperature, moisture and direct sunlight. For research lab handling only.

Research Applications

Used for pre‑clinical laboratory studies focused on antimicrobial mechanism research, innate immunity exploration, inflammatory cell biology and host‑defense peptide related pathway investigation. Not applicable for clinical treatment.

Product Advantages

1. High purity synthetic lyophilized peptide powder, batch‑to‑batch stable for lab test repeatability
2. Strict HPLC & MS batch testing, complete supporting lab documentation available
3. Fine lyophilized powder form, convenient for laboratory reconstitution and experimental operation
4. Qualified raw material for academic institute and biotech lab pre‑clinical peptide research

Packaging & Logistics

Standard packing: 5mg, 10mg,  sealed vial.

Outer package: Foam box + carton. Transportation: Normal cold chain transportation is optional. Goods will be well sealed to prevent moisture.

Company Profile

We are a high-tech enterprise oriented towards research and development, specializing in the fields of pharmaceutical raw materials, intermediates, peptide components, cosmetic raw materials, and nutritional supplement raw materials. We offer standardized large-scale production services and conduct global wholesale business. Our multiple peptide raw materials possess core physiological effects such as weight loss, muscle building, blood sugar reduction, and anti-aging, are widely applicable to the research and production demands in the pharmaceutical, beauty, and health care sectors.

We adopt strict batch production standards and have sufficient production capacity and stable supply capabilities. All products have been professionally tested by third-party institutions and come with complete test reports and qualification certificates, ensuring stable batch quality and complete traceability. For large-scale orders, we offer competitive wholesale prices. We uphold the core values of integrity, pragmatism, innovation and development, and continuously enhance our technical strength and product quality.

We offer comprehensive high-quality fine raw materials for the pharmaceutical, cosmetic and nutritional product industries. At the same time, we not only support standard batch purchases but also can meet the needs of pilot projects and large-scale industrial production.