 Home > Biochemical Engineering > Polypeptide > LL-37 for Sale > Cagrilintide+Semaglutide CS20| TongPeptides | 99% Purity |

Cagrilintide+Semaglutide CS20| TongPeptides | 99% Purity | buy - large image1

Cagrilintide+Semaglutide CS20| TongPeptides | 99% Purity | buy - image1

Cagrilintide+Semaglutide CS20| TongPeptides | 99% Purity | buy - image2

Cagrilintide+Semaglutide CS20| TongPeptides | 99% Purity | buy - image3

Cagrilintide+Semaglutide CS20| TongPeptides | 99% Purity | buy - image4

Cagrilintide+Semaglutide CS20| TongPeptides | 99% Purity |

Name: Cagrilintide+Semaglutide CS20| TongPeptides | 99% Purity |
Brand: Tongpeptide
SKU: pr2608241338
Price: 28 USD
Availability: InStock

TDS 3 Inquiries

Unit Price:

$28/UNIT FOB

Get Latest Price 

CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99.5%

Port:

CHINA

Brand:

Tongpeptide

Packaging:

mg*10vials

Price valid (until):

2026-09-24

Contact Supplier

 Chat Now

Tong peptides

Company Type:

Manufactory

Location:

China

Qualification:

Main Products:

retatrutide,TB-500,GHK-CU,peptide

 Visit Store

Product Description
Seller Information
Inquiry History

Description

Descriptiopn

Name:Alice

Whatsapp:+852 5513 4538

Email:alice@tongpeptides.com

Name:Alice

Whatsapp:+852 5513 4538

Email:alice@tongpeptides.com

CS20 is a high-performance refined synthetic bioactive peptide developed for premium daily physiological maintenance. Adopting a uniquely optimized amino acid sequence formula, this peptide boasts superior molecular stability and high biological activity efficiency, breaking the limitations of traditional single-effect peptide products. With balanced and powerful functional attributes, CS20 is dedicated to comprehensively improving bodily basic conditions, serving as a high-quality, reliable functional peptide for daily body care and state adjustment.

The core efficacy of CS20 focuses on bodily microenvironment repair and physiological state stabilization. This excellent bioactive peptide can effectively activate dormant cellular vitality, boost the efficiency of daily metabolic circulation, and alleviate sub-health problems caused by long-term stress, fatigue and irregular lifestyles. It works to regulate internal physiological balance, nourish basic body tissues, and enhance the body’s natural self-repairing and adaptive capacity. Different from intensely acting peptides, CS20 adopts a gentle and sustained activation mode, delivering gradual, durable and non-irritating conditioning effects, which allows for long-term continuous use to stabilize optimal physical status.

In terms of product quality and practical performance, CS20 features outstanding water solubility and ultra-high biological absorption rate. It dissolves rapidly and integrates efficiently with body tissues, stably exerting functional effects without efficacy loss. Produced through advanced precision synthesis and strict multi-stage purification craftsmanship, the product eliminates impure ingredients, achieving ultra-high purity and perfect batch consistency. Every finished product maintains stable activity and uniform effect, completely meeting high-standard daily functional application requirements.

CS20 is delivered in professional lyophilized powder form, which perfectly locks in the original high biological activity of the peptide and avoids active ingredient deactivation during storage. Scientific low-temperature sealed storage can effectively retain its core efficacy and prolong the product’s service life. Disclaimer: CS20 is for laboratory research use only. It is not applicable for human clinical diagnosis, treatment, cosmetic injection or any medical intervention purposes. All usage activities must comply with standardized laboratory operating guidelines and relevant industry regulations.

Shipping Method Shop KPV5KPV10-Detailed Image 3

Shop Samaglutide2mg,5mg,10mg,15mg,20mg,30mg-Detailed Image 11

Shop Samaglutide2mg,5mg,10mg,15mg,20mg,30mg-Detailed Image 13

Shop Samaglutide2mg,5mg,10mg,15mg,20mg,30mg-Detailed Image 14

Shop Samaglutide2mg,5mg,10mg,15mg,20mg,30mg-Detailed Image 15

Introduction to Our Factory

We are a professional and reliable peptide manufacturing factory in China, focusing on the R&D, production and supply of high-purity research-grade peptides and biochemical raw materials. Adhering to strict production standards and complete quality control systems, we are committed to providing cost-effective, high-quality peptide products and stable global supply services for international customers.

Quality is our core advantage. All our peptide products adopt advanced synthesis and purification technology, with universal HPLC purity over 99%. Every batch of goods undergoes strict laboratory testing, including high-performance liquid chromatography and mass spectrometry analysis. Complete test reports are provided to ensure stable ingredient content, low impurity rate and consistent product quality. All products are lyophilized and sealed in sterile independent vials to guarantee long-term stability during international transportation and storage.

Compared with other suppliers in the industry, we offer obvious price advantages. With independent production bases, standardized assembly lines and integrated supply chain management, we effectively reduce intermediate costs. We provide factory-direct wholesale prices while maintaining top-tier purity and quality, helping customers maximize profit margins with high cost performance.

Sufficient in-stock inventory covers mainstream peptide products, enabling rapid shipment within 1–3 working days after order confirmation. We have long-term cooperative professional freight teams, supporting stable and safe shipping to Europe, America, Southeast Asia, South America and other regions worldwide. With rich international export experience, our professional document sorting and standardized packaging greatly improve customs clearance pass rate, effectively avoiding customs detention risks and ensuring safe and smooth delivery of each order.

We always insist on standardized export procedures, stable quality control, competitive factory prices and efficient after-sales service, aiming to become your most trustworthy long-term peptide supply partner. All products are for laboratory research use only, not for human clinical use.

Q&A

Q1: Why should you buy from us instead of other suppliers?

A1: Because we are a factory, we can provide lower prices and guaranteed quality. We have extensive experience in domestic and foreign trade and provide services in an honest, timely and efficient manner.

Q2: When can I receive the package?

A2: It will be shipped as soon as possible after payment, and the shipping time is generally 7 to 12 days.

Q3: What is the minimum amount I can order?

A3: The minimum quantity we can order is 1 box, which contains 10vials.

Items	Specifications
CS20	20mg* 10vials

Shop KPV5KPV10-Detailed Image 20

Classification of the substance or mixture

Reproductive toxicity, Category 2

GHS label elements, including precautionary statements

Precautionary statement(s)
Pictogram(s)
Signal word	Warning
Hazard statement(s)	H361 Suspected of damaging fertility or the unborn child
Prevention	P203 Obtain, read and follow all safety instructions before use. P280 Wear protective gloves/protective clothing/eye protection/face protection/hearing protection/...
Response	P318 IF exposed or concerned, get medical advice.
Storage	P405 Store locked up.
Disposal	P501 Dispose of contents/container to an appropriate treatment and disposal facility in accordance with applicable laws and regulations, and product characteristics at time of disposal.

Other hazards which do not result in classification

ECHEMI Editorial Reference

LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.

Certificates

Basic Info

Product Name:

LL-37

Other Name:

Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

CAS No.:

154947-66-7

Molecular Formula:

C205H340N60O53

InChIKeys:

POIUWJQBRNEFGX-XAMSXPGMSA-N

Molecular Weight:

EC Number:

211-519-9

Color/Form:

White to off-white

Categories:

Polypeptide

Characteristics

Water Solubility:

Soluble to 1 mg/ml in water

Research

Class:

Amylin receptor (AMYR) / calcitonin receptor (CTR) agonist (long-acting amylin analog)

Status:

Investigational — Phase 3 (REDEFINE program, CagriSema combination)

Mechanism:

A novel long-acting, acylated amylin (islet amyloid polypeptide, IAPP) analog consisting of 38 amino acids. Cagrilintide activates the amylin receptor (AMYR) and calcitonin receptor (CTR), reducing food intake, delaying gastric emptying, and promoting satiety. Being developed as monotherapy and in fixed-dose combination with semaglutide (CagriSema) for obesity. Administered once weekly.

Activity note:

Cagrilintide is a non-selective AMYR/CTR agonist. Specific EC50 values not publicly available; functional potency is comparable to native amylin at AMYR.

Source:

MCE: Cagrilintide (CAS 1415456-99-3); Novo Nordisk REDEFINE program.

Clinical Development:

NCT05249895; NCT05249882

References

PubChem:

PubChem

Literature:

MCE: Cagrilintide (CAS 1415456-99-3); ClinicalTrials.gov: REDEFINE-1 (NCT05249895); Novo Nordisk: EASD 2025 Cagrilintide data presentation

Disclaimer:

Cagrilintide is NOT FDA-approved or EMA-approved. It is in Phase 3 clinical trials (REDEFINE program). This listing is for industrial and laboratory research use only. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

Seller Information

Business Type:
Manufactory

Main Products:
retatrutide,TB-500,GHK-CU,peptide

Location:
1-1, Kailuo Road, Taojia Town, Jiulongpo District, Chongqing

Payment Terms:
TT against copy of documents,L/C,TT against B/L draft before shipment,100% TT in advance

Total Annual Revenue:
$10 million-$25 million

Total Employees:
501-1000

Year of Establishment:
2023

Pharma Grade Peptides is your premium source for high-quality purified research peptides.

We have served over 20,000 customers on Alibaba and now offer the same quality at our independent store.

Over the course of many years, we have empowered researchers and scientists to
explore new avenues of scientific discovery.

Inquiry History

3 Inquiries

Country	Product	Purchase Quantity	Date Posted
Indonesia	LL 37	1	Aug 6, 2026
Indonesia	LL 37	1	Aug 6, 2026
Indonesia	LL-37	5 MG	Jun 23, 2026

Post an enquiry for this product

More Choices Find All Products for Sale 

Product Name	Grade / Content	Price	Supplier Name	Details
LL-37 CAS 154947-66-7 Factory wholesale and direct sale White powder Raw material peptide Weight reduction.	Pharmaceutical Grade/99		LingMi BioTechnology Co., Ltd	Inquiry
Factory direct sales high Purity peptide LL37 5mg white powder	Pharmaceutical Grade/99	$30-35/UNIT EXW	Yiwu Xiwu Technology Co., Ltd	Inquiry
LL37 10mg Vials Epitalon CAS 307297-39-8 Peptides Supply Ghk-Cu	Pharmaceutical Grade/99	$80/UNIT FOB	Haikou Mingheng	Inquiry
NP810-----++High purity, large quantity, discounted price. Direct delivery from the manufacturer.	Pharmaceutical Grade/99.9	$1-1.3/MT FOB	Hong Kong Biopetide Research Limited	Inquiry
Peptide White Powder LL-37 99% Purity LL37 Antimicrobial Peptide CAS:154947-66-7	Pharmaceutical Grade/99	$100-130/UNIT FOB		Inquiry

Cagrilintide+Semaglutide CS20| TongPeptides | 99% Purity |

Product Description

Seller Information

Inquiry History

Classification of the substance or mixture

GHS label elements, including precautionary statements

Other hazards which do not result in classification

More Choices Find All Products for Sale 

Related Searches