GND2 99% Purity Research Grade Peptide Lyophilized Powder with fast delivery for Sale
TDS 4 Inquiries
16941-32-5
Pharmaceutical Grade
99%
Shenzhen
PGpeptides
10 vials/kit
2026-09-24
Peptides
-
Product Description
-
Seller Information
-
Inquiry History
-
DescriptionECHEMI Editorial ReferenceWhite or almost white powderProduced by the α cells of the islands of Langerhans and also by the gastric mucosa. It is opposite in effect to insulin. It appears to be a straight-chain polypeptide with a molecular weight of approximately 3500. Small amounts have been detected in commproduced by recombinant DNA technology ismarketed by Novo Nordisk (glucagon [recombinant] hydrochloride,GlucaGen HypoKit, GlucaGen Diagnostic Kit)and by Eli Lilly (glucagon [recombinant] Emergency Kit). The hyperglyResearch & Reference Note
GND2 99% Purity Research Grade Peptide Lyophilized Powder with fast delivery for Sale is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.
Authoritative sourcesDisclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.
Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals
CertificatesBasic Info-
Product Name:
Glucagon
Other Name:GLUCAGON 1-37;GLUCAGON (1-37) (PORCINE);GLUCAGON 37;GLUCAGON ACETATE;HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA;H-HIS-SER-GLN-GLY-THR-PHE-THR-SER-ASP-TYR-SER-LYS-TYR-LEU-ASP-SER-ARG-ARG-ALA-GLN-ASP-PHE-VAL-GLN-TRP-LEU-MET-ASN-THR-LYS-ARG-ASN-LYS-ASN-ASN-ILE-ALA-OH;OXYNTOMODULIN (PORCINE);OXYNTOMODULIN
CAS No.:16941-32-5
Molecular Formula:C153H225N43O49S
InChIKeys:MASNOZXLGMXCHN-ZLPAWPGGSA-N
Molecular Weight:3482.75
Exact Mass:3480.615723
EC Number:232-708-2
HScode:2937190000
Categories:
Characteristics-
PSA:
1564.04000
XLogP3:-6.01
Appearance:powder
Density:1.53±0.1 g/cm3(Predicted)
Refractive Index:1.682
Water Solubility:Practically insoluble in water and in most organic solvents. It is soluble in dilute mineral acids and in dilute solutions of alkali hydroxides.
Storage Conditions:−20°C
Hazard IdentificationClassification of the substance or mixture
Skin sensitization, Category 1
Acute toxicity - Category 4, Inhalation
Respiratory sensitization, Category 1
GHS label elements, including precautionary statements
Pictogram(s)
Signal word Danger
Hazard statement(s) H317 May cause an allergic skin reaction
H332 Harmful if inhaled
H334 May cause allergy or asthma symptoms or breathing difficulties if inhaled
Precautionary statement(s) Prevention P261 Avoid breathing dust/fume/gas/mist/vapours/spray.
P272 Contaminated work clothing should not be allowed out of the workplace.
P280 Wear protective gloves/protective clothing/eye protection/face protection/hearing protection/...
P271 Use only outdoors or in a well-ventilated area.
P284 [In case of inadequate ventilation] wear respiratory protection.
Response P302+P352 IF ON SKIN: Wash with plenty of water/...
P333+P317 If skin irritation or rash occurs: Get medical help.
P321 Specific treatment (see ... on this label).
P362+P364 Take off contaminated clothing and wash it before reuse.
P304+P340 IF INHALED: Remove person to fresh air and keep comfortable for breathing.
P317 Get medical help.
P342+P316 If experiencing respiratory symptoms: Get emergency medical help immediately.
Storage none
Disposal P501 Dispose of contents/container to an appropriate treatment and disposal facility in accordance with applicable laws and regulations, and product characteristics at time of disposal.
Other hazards which do not result in classification
no data available
Handling and StoragePrecautions for safe handling
Handling in a well ventilated place. Wear suitable protective clothing. Avoid contact with skin and eyes. Avoid formation of dust and aerosols. Use non-sparking tools. Prevent fire caused by electrostatic discharge steam.
Conditions for safe storage, including any incompatibilities
Store the container tightly closed in a dry, cool and well-ventilated place. Store apart from foodstuff containers or incompatible materials.
-
-
Seller Information
-
Business Type:
Trader
-
Main Products:
Peptides
-
Location:
Y17, Room 310, East Third Floor, No. 64 and 66 Jianzhong Road, Tianhe District, Guangzhou City
-
Payment Terms:
TT against copy of documents,100% TT in advance
-
Average lead Time:
1
-
Total Employees:
11-50
-
Year of Establishment:
2026
-
-
Inquiry History4 Inquiries
Country Product Purchase Quantity Date Posted
Belgium
Glucagon 16941-32-5 Pharmaceutical grade
10 PCS Jan 8, 2026
Belgium
Glucagon (1-29)
5 MG Jan 9, 2026
Netherlands
glucagon
1000 KG Feb 15, 2024
Bulgaria
Glucagon, not retatrutide, just glucagon
1 G May 10, 2026 Post an enquiry for this product
- Hot Searches
- guar gum for incense
- reta weight loss where to buy
- nitrous acis
- methylenediphenyl diisocyanate
- where can you buy aniracetam
- where can i get retatrutide peptide
- methyl ethyl ketone for sale
- where can i get retatrutide
- ethylene vinyl acetate price
- boric acid 99
- acetic acid price
- methylene blue suppliers
