Product
Supplier
Encyclopedia
Inquiry
Home > Biochemical Engineering > Polypeptide > LL-37 for Sale > L-Carnitine | TongPeptides | 99% Purity | LC500 | Shipped from China Factory
L-Carnitine | TongPeptides | 99% Purity | LC500 | Shipped from China Factory buy - large image1
L-Carnitine | TongPeptides | 99% Purity | LC500 | Shipped from China Factory buy - image1
L-Carnitine | TongPeptides | 99% Purity | LC500 | Shipped from China Factory buy - image2
L-Carnitine | TongPeptides | 99% Purity | LC500 | Shipped from China Factory buy - image3
L-Carnitine | TongPeptides | 99% Purity | LC500 | Shipped from China Factory buy - image4
L-Carnitine | TongPeptides | 99% Purity | LC500 | Shipped from China Factory buy - image5
L-Carnitine | TongPeptides | 99% Purity | LC500 | Shipped from China Factory buy - image6

L-Carnitine | TongPeptides | 99% Purity | LC500 | Shipped from China Factory

TDS 3 Inquiries

Unit Price:

$65/UNIT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

China

Brand:

Tong peptide

Packaging:

10ml/1box*10vials

Price valid (until):

2026-08-31

Company Type:
Manufactory
Location:
China
Qualification:
Main Products:

retatrutide,TB-500,GHK-CU,peptide

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


    Name: Iris

    WhatsApp: +852 7094 7882
    Email: iris@tongpeptides.com


    L-Carnitine is a naturally occurring bioactive amino acid derivative that exists widely in human tissues and daily animal-based foods. As an essential endogenous substance closely linked to energy metabolism, it plays a fundamental role in assisting bodily energy conversion and maintaining physical vitality. The human body can synthesize L-Carnitine naturally, while additional gentle supplementation helps fill nutritional gaps caused by dietary habits, high physical consumption and individual metabolic differences. Due to its excellent biological compatibility and stable metabolic supporting properties, it has long been a mainstream research subject in daily physical conditioning and sub-health wellness maintenance.​
    
    The core physiological value of L-Carnitine lies in its efficient energy transport function within cells. It acts as a natural metabolic carrier, assisting in transporting fatty substances into cellular energy factories for decomposition and conversion into usable physical energy. This gentle and natural metabolic optimization helps improve low energy efficiency caused by slow fat metabolism, effectively relieving daily physical fatigue, sluggishness and heavy body feelings brought by long-term sedentary lifestyles and unbalanced diets. It supports the body’s benign energy circulation and maintains a light and energetic physical state.​
    
    In long-term observational research, moderate supplementation of L-Carnitine delivers positive support for body composition management and physical endurance. It helps optimize the body’s lipid metabolic rhythm, reduce accumulated metabolic waste caused by unspent energy, and improve the sub-health state of slow basal metabolism. For people with regular exercise habits, it assists in sustaining stable physical output, alleviating exercise-induced physical soreness and fatigue accumulation, and accelerating post-workout physical recovery, laying a solid foundation for long-term physical condition maintenance.​
    
    L-Carnitine features mild properties and high safety in conventional nutritional application. It is consistent with the body’s inherent metabolic mechanism and will not cause abrupt physiological changes or dependency. Most people can achieve steady metabolic conditioning through standardized and cyclic supplementation. It is especially suitable for modern groups with insufficient daily activity, irregular diets and easy physical fatigue to improve overall metabolic vitality.​
    
    It is necessary to clarify that the relevant descriptions are based on public nutritional research data and are for daily wellness reference only. L-Carnitine is a common nutritional conditioning ingredient, not a medical product or therapeutic intervention. It cannot replace professional medical diagnosis and treatment. People with special physical conditions or long-term medication habits are advised to consult professional health practitioners before supplementation to ensure safe and reasonable daily wellness conditioning.

    Shop L-Carnitine | TongPeptides | 99% Purity | LC500 | Shipped from China Factory-Detailed Image 1
    Shop L-Carnitine | TongPeptides | 99% Purity | LC500 | Shipped from China Factory-Detailed Image 2
    Shop L-Carnitine | TongPeptides | 99% Purity | LC500 | Shipped from China Factory-Detailed Image 3
    Shop L-Carnitine | TongPeptides | 99% Purity | LC500 | Shipped from China Factory-Detailed Image 4
    Shop L-Carnitine | TongPeptides | 99% Purity | LC500 | Shipped from China Factory-Detailed Image 5
    Shop L-Carnitine | TongPeptides | 99% Purity | LC500 | Shipped from China Factory-Detailed Image 6
    Shop L-Carnitine | TongPeptides | 99% Purity | LC500 | Shipped from China Factory-Detailed Image 7

    Shop L-Carnitine | TongPeptides | 99% Purity | LC500 | Shipped from China Factory-Detailed Image 8 Shop L-Carnitine | TongPeptides | 99% Purity | LC500 | Shipped from China Factory-Detailed Image 9 Shop L-Carnitine | TongPeptides | 99% Purity | LC500 | Shipped from China Factory-Detailed Image 10

    Why Choose Us

    Strict‑Standard Quality Inspection

    Each batch comes with complete test files, including HPLC‑based purity reports and mass‑spectrometry identification in the Certificate of Analysis (CoA). Typical purity exceeds 98%. We guarantee stable product identification, high purity and consistent quality across batches.

    Lab‑Oriented Raw‑Material Supplier

    Our biochemical raw materials cater to research‑and‑development labs, pre‑clinical trials, and commercial production in the biotechnology, skincare and nutritional‑supplement sectors.

    Stable Worldwide Logistics Service

    Cooperating with trusted logistics providers, we provide safe, confidential and temperature‑controlled international delivery, making sure goods arrive safely and on schedule.

    Flexible Service for Different‑Order Demands

    We support small lab‑use samples as well as large‑scale bulk purchases. Qualified clients can access customized purity adjustment, ingredient mixing and private‑label packaging services.

    FAQ

    Q1. How do you ensure product quality?
    A: We have a strict quality management system, all batches must be tested and meet our standards before entering the warehouse. The purity of all our products is above 99.00%, which has been verified by many American and European customers.
     
     
    Q2. How to place an order with you?
    A: Once we confirm the required dosage/strength and quantity of the product with the customer, and the customer confirms and makes payment, we will arrange shipment as soon as possible.
     
     
    Q3. What payment methods are there?
    A: There are Bank Transfer, Tether USD(USDT) and Bitcoin(BTC).
     
     
    Q4. What shipping methods can we choose?
    A: Usually express delivery is more suitable, including DHL, FedEx, UPS, etc. We will be responsible for customs clearance in the destination country, and customers are not required to cooperate with customs clearance and pay any tariffs.

    If you would like to know more about product quality, purity data, dosage guidance and professional product efficacy information, feel free to get in touch with us. We are a Chinese integrated factory combining production and trade, and we can offer you competitive factory‑direct prices.

    Reach me via WhatsApp: +852 7094 7882

    ECHEMI Editorial Reference
    LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.
    Research & Reference Note

    L-Carnitine | TongPeptides | 99% Purity | LC500 | Shipped from China Factory is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals

    Certificates
    • L-Carnitine | TongPeptides | 99% Purity | LC500 | Shipped from China Factory Certificates 1 TDS

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Polypeptide

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Manufactory

    Main Products:

    retatrutide,TB-500,GHK-CU,peptide

    Location:

    1-1, Kailuo Road, Taojia Town, Jiulongpo District, Chongqing

    Payment Terms:

    TT against copy of documents,L/C,TT against B/L draft before shipment,100% TT in advance

    Total Annual Revenue:

    $10 million-$25 million

    Total Employees:

    501-1000

    Year of Establishment:

    2023

    Pharma Grade Peptides is your premium source for high-quality purified research peptides.

    We have served over 20,000 customers on Alibaba and now offer the same quality at our independent store.

    Over the course of many years, we have empowered researchers and scientists to
    explore new avenues of scientific discovery.

  • Inquiry History
    3 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL 37

    1  Aug 6, 2026
    Indonesia

    LL 37

    1  Aug 6, 2026
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.