 Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > Teriparatide acetate for Sale > Factory Direct Bulk Teriparatide Peptide Raw Material Lyophilized Powder In Large Quantity

Factory Direct Bulk Teriparatide Peptide Raw Material Lyophilized Powder In Large Quantity buy - large image1

Factory Direct Bulk Teriparatide Peptide Raw Material Lyophilized Powder In Large Quantity buy - image1

Factory Direct Bulk Teriparatide Peptide Raw Material Lyophilized Powder In Large Quantity buy - image2

Factory Direct Bulk Teriparatide Peptide Raw Material Lyophilized Powder In Large Quantity buy - image3

Factory Direct Bulk Teriparatide Peptide Raw Material Lyophilized Powder In Large Quantity buy - image4

Factory Direct Bulk Teriparatide Peptide Raw Material Lyophilized Powder In Large Quantity

15 Inquiries

Unit Price:

$6-7/UNIT FOB

Get Latest Price 

CAS No.:

52232-67-4

Grade:

Pharmaceutical Grade

Content:

99%

Port:

shenzhen

Brand:

Packaging:

vial,box

Price valid (until):

2028-08-28

Contact Supplier

 Chat Now

Jielu Trading

Company Type:

Trader

Location:

China

Average Lead Time:

15 days

Qualification:

Main Products:

Peptide

 Visit Store

Product Description
Seller Information
Inquiry History

Description

Product Detail

WhatsApp ：+852 47107541 WhatsApp：+85247107541

Our products enjoy good reputation both at home and abroad. Our trade partners are around the world, mainly in America,Europe,Australia,South East Asia ,Middle East and South Africa. In order to serve customers well, the company has established special technical department and after-sale service department. We will make careful reply if you get any question.

The company with all the employees will constantly purse excellent quality, perfect brand and our image, and adheres to our spirit of honesty, diligence, seeking truth and progress and insists on business philosophy of quality as life and service as soul. We will satisfy market demands by top products and better service, and will welcome market challenge forever.

Peptides

Peptides are compounds formed by connecting alpha amino acids together through peptide bonds, and are intermediate products of protein hydrolysis. A compound formed by dehydration condensation of two amino acid molecules is called a dipeptide, and similarly, there are also tripeptides, tetrapeptides, pentapeptides, and so on. A peptide composed of three or more amino acid molecules is called a polypeptide.

Weight Loss

we specialize in weight loss packages for anyone looking for a total body transformation using a customized peptide package that is tailored just for your body. Our peptides have been around for decades but only to cater to the rich and famous. But now, we have brought their successful, customized treatments to the general public. Patients begin to see results and feel the effects in as quick as three weeks, transforming their bodies and feeling stronger and more energetic. Let us help you get your edge back.

This program covers everything from fat loss to introductory muscle building. If you have struggled to get weight off and keep it off, this may be a great option for you!

Wholesale price Factory price top quality

Shop Factory supply Lyophilized SS-31-Detailed Image 1

Shop Factory supply Lyophilized SS-31-Detailed Image 2

Product Packaging

Shop Factory supply Lyophilized SS-31-Detailed Image 3

FAQ

Why choose us?

Professional, Rich Experience.

1)Rich experience for Europe&North America&South America&Middle East&Asiaexport.

2)Full experience of large numbers containers loading in Chinese sea port.

Our Advantages.

1)All purity>99%.

2)High quality with competitive price.

3)We are manufacturer and can provide high quality products with factory price.

Fast and safe delivery.

1)Parcel can be sent out in 24 hours after payment tracking number available.

2)Secure and discreet shipment verious transportation methods for your choice.

3)Customs pass rate >99%.

We have clients throughout the world.

1)Professional service and rich experience make customers feel at ease, adequate stock and fast delivery meet their different desire.

2)Market feedback and goods feedback will be appreciated, meeting customers' requirement is our principal responsibility.

3)High quality, competitive price, fast delivery, first-class service gain the trust and praise from all the customers.

How to proceed your order:

Step 1:Please let me know the items you are favorable, quantities, and the destination country.

Step 2:You confirm all detail, and offer purchasing order.

Step 3:We send the detail price of our product and offer the suitable shipping method for reference.

Step 4:You confirm the order and payment 100% in advance and send us the detailed contacting information, including contacting person/company,address,mobile number,ZIP code and your special requirements.

Step5:We arrange the shipment according to your requirements, and tracking code will be offered once it is released, then you can track your parcel at any moment.

Step 6:We offer after-sales services after service after you receive your parcel

Items	Specifications
Brand name	Teriparatide
Purity	99%
Appearance	White powder

ECHEMI Editorial Reference

The anabolic drug teriparatide acetate (TA), known as recombinant human parathyroid hormone 1–34, which directly promotes bone formation by generating new osteocytes, has been introduced as a novel therapeutic agent for osteoporosis. Distinct from antiresorptive drug treatment, patients with osteonecrosis of the jaw showed successful clinical outcomes after weekly administration of TA. In addition, adverse outcomes of long-term bisphosphonate treatment, such as bone fracture, were healed after usage of TA, and better bone mass and mineral density improvements at the lumbar spine and femoral neck were achieved with TA treatment than with bisphosphonate treatment[1].
Teriparatide is a recombinantform of parathyroid hormone, which is used for the treatmentof osteoporosis in men and postmenopausal women.The N-terminal region possesses 34 amino acids, which areidentical to the biologically active region of the 84-aminoacid sequence of human parathyroid hormone. It has beenshown to act on osteoblasts to stimulate new bone growthand improve bone density.
Parathyroid Hormone Human Synthetic (C181H291N55O51S2) contains 34 amino acids and has a molecular mass of 4117.72 Dalton.The PTH is purified by proprietary chromatographic techniques.

Research & Reference Note

Factory Direct Bulk Teriparatide Peptide Raw Material Lyophilized Powder In Large Quantity is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

Authoritative sources

Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals

Basic Info

Product Name:

Teriparatide acetate

Other Name:

PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF;SER-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE

CAS No.:

52232-67-4

Molecular Formula:

C172H278N52O47S2

InChIKeys:

BUUKFBVDKSFMHN-LKMAISLMSA-N

Molecular Weight:

3890.49792

EC Number:

640-978-1

Color/Form:

White to Off-White

HScode:

2937190000

Categories:

Bulk Drug Intermediates

Characteristics

Melting Point:

>205oC (dec.)

Water Solubility:

Soluble to 0.40 mg/ml in water

Critical Temperature & Pressure:

−20°C

See More Teriparatide acetate Properties 

Hazard Identification

Classification of the substance or mixture

Carcinogenicity, Category 2

Reproductive toxicity, Category 2

GHS label elements, including precautionary statements

Precautionary statement(s)
Pictogram(s)
Signal word	Warning
Hazard statement(s)	H351 Suspected of causing cancer H361 Suspected of damaging fertility or the unborn child
Prevention	P203 Obtain, read and follow all safety instructions before use. P280 Wear protective gloves/protective clothing/eye protection/face protection/hearing protection/...
Response	P318 IF exposed or concerned, get medical advice.
Storage	P405 Store locked up.
Disposal	P501 Dispose of contents/container to an appropriate treatment and disposal facility in accordance with applicable laws and regulations, and product characteristics at time of disposal.

Other hazards which do not result in classification

no data available

Handling and Storage

Precautions for safe handling

Handling in a well ventilated place. Wear suitable protective clothing. Avoid contact with skin and eyes. Avoid formation of dust and aerosols. Use non-sparking tools. Prevent fire caused by electrostatic discharge steam.

Conditions for safe storage, including any incompatibilities

Store the container tightly closed in a dry, cool and well-ventilated place. Store apart from foodstuff containers or incompatible materials.

See More Teriparatide acetate Safety Data Sheet 

Seller Information

Business Type:
Trader

Main Products:
Peptide

Location:
zhejiangshengjinhuashiyiwushijiangdongjiedaodongnanlu656hao

Average lead Time:
15 days

Total Annual Revenue:
$1 million-$2.5 million

Total Employees:
5-10

Year of Establishment:
2026

Jielu Trading focuses on the global cross‑border supply chain of high‑end peptide raw materials. Rooted in cutting‑edge biotechnology, we specialize in the selection, quality control, trade and globalized services of peptide products.

Adhering to strict quality standards and raw material traceability systems, we provide high‑purity and stable peptide raw materials as well as integrated supply‑chain solutions for scientific research, health care and medical aesthetics industries with standardized production and complete compliance qualifications.

Guided by our brand philosophy With Peptide Power, Integrity Leads Far, Empowering the World, Jielu builds a stable and efficient global trade network with craftsmanship, integrity and global vision. We strive to be an influential benchmark service provider in the worldwide peptide industry, and create a brighter future with global partners.

Inquiry History

15 Inquiries

Country	Product	Purchase Quantity	Date Posted
United States	Teriparatide	1 KG	May 28, 2026
United States	teriparatide	1 G	Sep 6, 2026
Russia	teriparatide	100 MG	Feb 23, 2026
Kazakstan	Teriparatide	1 KG	Jan 4, 2026
Kazakstan	Teriparatide	5 MG	Jan 1, 2026
Kazakstan	teriparatide	1 KG	Nov 17, 2025
United States	Teriparatide	10 MT	May 29, 2026
Bulgaria	teripatatide	1	May 17, 2026
Kazakstan	Teriparatide	5 MG	Jan 2, 2026
United Kingdom	Supply	1	Mar 5, 2024
Russia	Teriparatide	1 G	Sep 12, 2026
Russia	Teriparatide	1 G	Sep 12, 2026
United States	Teriparatide kit of 10 2mg vials	1 MT	Sep 7, 2026
Germany	Teriparatide Acetate	5 MG	Jul 5, 2026
Belgium	Erdafitinib	10 G	Sep 20, 2026

Post an enquiry for this product

More Choices Find All Products for Sale 

Product Name	Grade / Content	Price	Supplier Name	Details
High Grade Peptide Powder CAS 52232-67-4 Teriparatide Acetate Blend Peptide 10mg Vials	Pharmaceutical Grade/99	$10/UNIT FOB	Jinan Pingxing Trading Co., Ltd.	Inquiry
Teriparatide 52232-67-4	Reagent Grade/95	$800-900/G FOB	cellmano peptide	Inquiry
Teriparatide 99% white powder High purity Adamax Raw white Powder 5mg 10mg	Pharmaceutical Grade/99	$35-45/UNIT EXW	Anhui Ruibang Trading Co., Ltd	Inquiry
Best Price Pure 98% Teriparatide Raw Powder Teriparatide Acetate CAS 52232-67-4	Pharmaceutical Grade/99	$367.24-377.44/G FOB	Runlian peptide supplier	Inquiry
High quality and high purity 99% Teriparatide Acetate cas 52232-67-4	Pharmaceutical Grade/99	$1/UNIT FOB	Shandong Xinshunyue Energy Co., Ltd.	Inquiry

Factory Direct Bulk Teriparatide Peptide Raw Material Lyophilized Powder In Large Quantity

Product Description

Seller Information