Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > Glucagon for Sale > GND2 GND2 High Quality GND2 99% Purity Research Grade Peptide Lyophilized Powder 2mg/Vial factory direct supply, door-to-door delivery.
GND2 GND2 High Quality GND2 99% Purity Research Grade Peptide Lyophilized Powder 2mg/Vial factory direct supply, door-to-door delivery. buy - large image1
GND2 GND2 High Quality GND2 99% Purity Research Grade Peptide Lyophilized Powder 2mg/Vial factory direct supply, door-to-door delivery. buy - image1
GND2 GND2 High Quality GND2 99% Purity Research Grade Peptide Lyophilized Powder 2mg/Vial factory direct supply, door-to-door delivery. buy - image2
GND2 GND2 High Quality GND2 99% Purity Research Grade Peptide Lyophilized Powder 2mg/Vial factory direct supply, door-to-door delivery. buy - image3
GND2 GND2 High Quality GND2 99% Purity Research Grade Peptide Lyophilized Powder 2mg/Vial factory direct supply, door-to-door delivery. buy - image4
GND2 GND2 High Quality GND2 99% Purity Research Grade Peptide Lyophilized Powder 2mg/Vial factory direct supply, door-to-door delivery. buy - image5
GND2 GND2 High Quality GND2 99% Purity Research Grade Peptide Lyophilized Powder 2mg/Vial factory direct supply, door-to-door delivery. buy - image6

GND2 GND2 High Quality GND2 99% Purity Research Grade Peptide Lyophilized Powder 2mg/Vial factory direct supply, door-to-door delivery.

TDS 4 Inquiries

Unit Price:

$37/G FOB

Get Latest Price
CAS No.:

16941-32-5

Grade:

Pharmaceutical Grade

Content:

99%

Port:

HongKong

Brand:

customizable

Packaging:

10 bottles per box

Price valid (until):

2026-12-31

Company Type:
Trader
Location:
China
Qualification:
Main Products:

GHK-CU,RETATRUTIDE

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Contact Information  





    WhatsAPP:+86 15550069263
    Email:leila96292338@gmail.com



      Factory Overview 


    Guangzhou Changkai Trading Co., Ltd. is a high-tech enterprise specializing in peptide drugs. We are committed to providing the global biomedical industry with full-cycle, one-stop peptide drug CRDMO services, encompassing early discovery, preclinical research, clinical development, and commercial production. With our mission of "making peptide drugs more accessible", we have become a significant force in the domestic and even global peptide industry, leveraging our core technological expertise and large-scale production advantages in the field of peptide synthesis.

    Shop TR5 TR5 Top Quality Peptides Lyophilized Powder Tirzepatide Fitness and Weight Loss-Detailed Image 1 Shop TR5 TR5 Top Quality Peptides Lyophilized Powder Tirzepatide Fitness and Weight Loss-Detailed Image 2 Shop TR5 TR5 Top Quality Peptides Lyophilized Powder Tirzepatide Fitness and Weight Loss-Detailed Image 3


      Product Detail  


    Tirzepatide is a dual GIP and GLP-1 receptor agonist studied for its effects on incretin signaling, glucose regulation, appetite pathways, and body composition. By activating two complementary metabolic receptors, Tirzepatide offers researchers a broader model than GLP-1-only compounds. It is commonly evaluated in studies focused on insulin response, satiety signaling, energy balance, and comparative metabolic outcomes across single-agonist and dual-agonist peptide platforms. Taken together, these characteristics position the material for structured studies where pathway-specific activity, comparative response, and consistency across experimental conditions matter.

    Shop TR5 TR5 Top Quality Peptides Lyophilized Powder Tirzepatide Fitness and Weight Loss-Detailed Image 4

    Tirzepatide generally produces greater average weight loss than semaglutide and is often better tolerated, although both medications have similar gastrointestinal side-effect profiles.

    Items Specifications
    Category Peptides
    Bottle Color Transparent
    Purity 99%
    Specification 5mg, 10mg, 15mg, 20mg, 30mg, etc


    What is a peptide?

    Peptides are small molecules that lie between amino acids and proteins. They have a smaller molecular weight and do not require decomposition. They can be directly absorbed and utilized by the human body, with a much higher utilization rate than ordinary proteins.

    Shop TR5 TR5 Top Quality Peptides Lyophilized Powder Tirzepatide Fitness and Weight Loss-Detailed Image 5
    The peptide products available on the market have undergone process purification to remove large molecular impurities, making them suitable for daily body supplementation. As people age, their body's ability to synthesize peptides decreases, leading to problems such as skin sagging, slowed metabolism, and reduced physical strength. Exogenous supplementation can fill the gap.

    Shop TR5 TR5 Top Quality Peptides Lyophilized Powder Tirzepatide Fitness and Weight Loss-Detailed Image 6
    Oral peptides can regulate the body's condition, repair internal cells, improve sleep quality, regulate basal metabolism, and help maintain energy; topical skin care peptides can soothe fine lines, firm the skin texture, and repair the damaged skin barrier.

    Shop TR5 TR5 Top Quality Peptides Lyophilized Powder Tirzepatide Fitness and Weight Loss-Detailed Image 7
    This product is gentle in composition and suitable for most skin types, differentiating it from ordinary health supplements. By taking it in appropriate amounts on a daily basis, it can improve one's complexion from within and delay signs of aging. The peptides are absorbed quickly and cause little burden on the stomach and intestines. Whether for daily maintenance or for people who stay up late or have irregular sleep schedules, it is suitable as a long-term maintenance option to achieve a state improvement from the inside out.

    Shop TR5 TR5 Top Quality Peptides Lyophilized Powder Tirzepatide Fitness and Weight Loss-Detailed Image 8


    Peptide classification
    Peptides are mainly classified based on their molecular structure into large molecule polypeptides, small molecule oligopeptides, as well as dipeptides and tripeptides. According to their application directions, they can be further divided into two categories: cosmetic peptides and health-promoting active peptides.
    Shop TR5 TR5 Top Quality Peptides Lyophilized Powder Tirzepatide Fitness and Weight Loss-Detailed Image 9
    Health-promoting active peptides can be rapidly absorbed by the digestive system and participate in body metabolism. They can repair body cells, regulate immunity, alleviate fatigue and weakness, and also regulate blood sugar and lipid levels, nourish the stomach and intestines, repair the mucosa, slow down the aging of body functions, and are suitable for the daily treatment of people with sub-health conditions.
    Shop TR5 TR5 Top Quality Peptides Lyophilized Powder Tirzepatide Fitness and Weight Loss-Detailed Image 10
    ECHEMI Editorial Reference
    White or almost white powderProduced by the α cells of the islands of Langerhans and also by the gastric mucosa. It is opposite in effect to insulin. It appears to be a straight-chain polypeptide with a molecular weight of approximately 3500. Small amounts have been detected in commproduced by recombinant DNA technology ismarketed by Novo Nordisk (glucagon [recombinant] hydrochloride,GlucaGen HypoKit, GlucaGen Diagnostic Kit)and by Eli Lilly (glucagon [recombinant] Emergency Kit). The hypergly
    Research & Reference Note

    GND2 GND2 High Quality GND2 99% Purity Research Grade Peptide Lyophilized Powder 2mg/Vial factory direct supply, door-to-door delivery. is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals

    Certificates
    • GND2 GND2 High Quality GND2 99% Purity Research Grade Peptide Lyophilized Powder 2mg/Vial factory direct supply, door-to-door delivery. Certificates 1 TDS

    Basic Info
    Product Name:

    Glucagon

    Other Name:

    GLUCAGON 1-37;GLUCAGON (1-37) (PORCINE);GLUCAGON 37;GLUCAGON ACETATE;HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA;H-HIS-SER-GLN-GLY-THR-PHE-THR-SER-ASP-TYR-SER-LYS-TYR-LEU-ASP-SER-ARG-ARG-ALA-GLN-ASP-PHE-VAL-GLN-TRP-LEU-MET-ASN-THR-LYS-ARG-ASN-LYS-ASN-ASN-ILE-ALA-OH;OXYNTOMODULIN (PORCINE);OXYNTOMODULIN

    CAS No.:

    16941-32-5

    Molecular Formula:

    C153H225N43O49S

    InChIKeys:

    MASNOZXLGMXCHN-ZLPAWPGGSA-N

    Molecular Weight:

    3482.75

    Exact Mass:

    3480.615723

    EC Number:

    232-708-2

    HScode:

    2937190000

    Characteristics
    PSA:

    1564.04000

    XLogP3:

    -6.01

    Appearance:

    powder

    Density:

    1.53±0.1 g/cm3(Predicted)

    Refractive Index:

    1.682

    Water Solubility:

    Practically insoluble in water and in most organic solvents. It is soluble in dilute mineral acids and in dilute solutions of alkali hydroxides.

    Storage Conditions:

    −20°C

    Hazard Identification

    Classification of the substance or mixture

    Skin sensitization, Category 1

    Acute toxicity - Category 4, Inhalation

    Respiratory sensitization, Category 1

    GHS label elements, including precautionary statements

    Pictogram(s)
    Signal word

    Danger

    Hazard statement(s)

    H317 May cause an allergic skin reaction

    H332 Harmful if inhaled

    H334 May cause allergy or asthma symptoms or breathing difficulties if inhaled

    Precautionary statement(s)
    Prevention

    P261 Avoid breathing dust/fume/gas/mist/vapours/spray.

    P272 Contaminated work clothing should not be allowed out of the workplace.

    P280 Wear protective gloves/protective clothing/eye protection/face protection/hearing protection/...

    P271 Use only outdoors or in a well-ventilated area.

    P284 [In case of inadequate ventilation] wear respiratory protection.

    Response

    P302+P352 IF ON SKIN: Wash with plenty of water/...

    P333+P317 If skin irritation or rash occurs: Get medical help.

    P321 Specific treatment (see ... on this label).

    P362+P364 Take off contaminated clothing and wash it before reuse.

    P304+P340 IF INHALED: Remove person to fresh air and keep comfortable for breathing.

    P317 Get medical help.

    P342+P316 If experiencing respiratory symptoms: Get emergency medical help immediately.

    Storage

    none

    Disposal

    P501 Dispose of contents/container to an appropriate treatment and disposal facility in accordance with applicable laws and regulations, and product characteristics at time of disposal.

    Other hazards which do not result in classification

    no data available

    Handling and Storage

    Precautions for safe handling

    Handling in a well ventilated place. Wear suitable protective clothing. Avoid contact with skin and eyes. Avoid formation of dust and aerosols. Use non-sparking tools. Prevent fire caused by electrostatic discharge steam.

    Conditions for safe storage, including any incompatibilities

    Store the container tightly closed in a dry, cool and well-ventilated place. Store apart from foodstuff containers or incompatible materials.

  • Seller Information
    Business Type:

    Trader

    Main Products:

    GHK-CU,RETATRUTIDE

    Location:

    Guangzhou Changkai Trading Co., Ltd.

    Payment Terms:

    TT against copy of documents,D/P,L/C,D/A,O/A,TT against B/L draft before shipment,100% TT in advance

    Average lead Time:

    5

    Total Employees:

    11-50

    Year of Establishment:

    2026

  • Inquiry History
    4 Inquiries
    Country Product Purchase Quantity Date Posted
    Belgium

    Glucagon 16941-32-5 Pharmaceutical grade

    10 PCS Jan 8, 2026
    Belgium

    Glucagon (1-29)

    5 MG Jan 9, 2026
    Netherlands

    glucagon

    1000 KG Feb 15, 2024
    Bulgaria

    Glucagon, not retatrutide, just glucagon

    1 G May 10, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.