Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > Teriparatide acetate for Sale > Teriparatide 10mg Research Material, Peptide Powder for Laboratory Use
Teriparatide 10mg Research Material, Peptide Powder for Laboratory Use buy - large image1
Teriparatide 10mg Research Material, Peptide Powder for Laboratory Use buy - image1
Teriparatide 10mg Research Material, Peptide Powder for Laboratory Use buy - image2
Teriparatide 10mg Research Material, Peptide Powder for Laboratory Use buy - image3
Teriparatide 10mg Research Material, Peptide Powder for Laboratory Use buy - image4
Teriparatide 10mg Research Material, Peptide Powder for Laboratory Use buy - image5
Teriparatide 10mg Research Material, Peptide Powder for Laboratory Use buy - image6

Teriparatide 10mg Research Material, Peptide Powder for Laboratory Use

TDS 10 Inquiries

Unit Price:

$50/UNIT FOB

Get Latest Price
CAS No.:

52232-67-4

Grade:

Research Grade

Content:

99%

Port:

深圳

Brand:

Generic

Packaging:

10mg/Vial

Price valid (until):

2026-10-01

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Peptides

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


    Name:Elare

    Whatsapp:+852 5535 7215

    Please add me for our latest price list and COA


      Product Detail  






    Teriparatide 10mg Research Material

    Product Overview

    Product Name: Teriparatide
    Net Content: 10 mg
    Package: 10 mg/vial
    Material Type: Research Material
    Intended Application: Laboratory and Research Use

    Teriparatide is a peptide-based research material supplied in a convenient 10 mg package. This product is intended for qualified customers conducting permitted laboratory, analytical, biochemical, and other legitimate non-clinical research activities.

    The product is supplied according to the applicable batch specification. Customers should refer to the relevant product documentation and batch-specific Certificate of Analysis (COA) for the definitive information concerning identity, purity, appearance, storage conditions, and other quality parameters.

    Product Description

    Teriparatide is supplied as a 10 mg research material in vial packaging. The package size provides a convenient quantity for laboratory evaluation, analytical research, and other permitted research applications.

    The product should be identified and evaluated according to the actual batch documentation. Technical information, including purity, appearance, physical form, storage requirements, and analytical characteristics, may vary according to the specific batch and formulation.

    Customers requiring particular specifications should confirm the applicable requirements before purchase. The actual product specification and batch documentation take precedence over general information provided on this page.

    Product Specification

    • Product Name: Teriparatide
    • Net Content: 10 mg
    • Packaging: 10 mg/vial
    • Material Type: Research Material
    • Product Form: According to actual batch
    • Appearance: According to actual batch specification
    • Purity: According to actual batch COA
    • Storage: According to applicable product documentation
    • Application: Research and laboratory use

    All technical specifications should be verified against the actual batch documentation before use.

    Quality Information

    We aim to provide accurate product identification and batch-based quality information for professional customers.

    Depending on the actual batch and documentation available, relevant quality documentation may include:

    • Certificate of Analysis (COA)
    • Product specification
    • Batch information
    • Packaging information
    • Storage information
    • Applicable quality-control documentation

    Customers with specific analytical or quality requirements should confirm their requirements before ordering. Where available, relevant batch documentation may be provided for professional evaluation.

    The information stated in the applicable batch documentation should be regarded as the controlling technical information for the supplied material.

    Packaging

    The standard listed quantity is 10 mg per vial.

    The vial format provides a convenient package size for laboratory and research applications. Packaging configuration, labeling, and other packaging characteristics may vary according to the actual batch and order requirements.

    Customers requiring a particular packaging configuration should confirm the requirements before purchase.

    Storage

    Teriparatide should be stored in accordance with the conditions specified in the applicable product documentation and batch COA.

    Keep the container properly closed when not in use and maintain appropriate storage conditions to preserve the quality of the material.

    Avoid unnecessary exposure to unsuitable environmental conditions. For long-term storage, customers should follow the storage recommendations supplied with the actual product documentation.

    Storage requirements may depend on the specific formulation and batch. Therefore, the applicable product documentation should always be consulted.

    Laboratory and Research Use

    Teriparatide is offered as a research material for qualified customers and permitted laboratory applications.

    Potential legitimate applications may include analytical evaluation, biochemical research, laboratory testing, material characterization, assay development, and other permitted non-clinical research activities, subject to applicable laws and regulations.

    The information provided on this page is intended for general product identification and commercial reference only.

    This listing does not provide medical, therapeutic, clinical, or dosing advice. No claims are made regarding the prevention, diagnosis, treatment, or cure of any disease or medical condition.

    The product is not represented on this page as a finished pharmaceutical product, dietary supplement, food product, medical device, or cosmetic product.

    Regulatory Compliance

    Customers are responsible for determining whether the purchase, possession, transportation, importation, storage, handling, and intended use of Teriparatide comply with applicable laws and regulations.

    For international transactions, buyers should independently verify applicable customs, import, export, transportation, and regulatory requirements in the destination country or region.

    Where permits, registrations, declarations, licenses, or other regulatory documentation are required, customers should obtain the necessary approvals before purchasing or importing the product.

    The material should be handled by appropriately qualified personnel in accordance with applicable laboratory safety procedures, institutional requirements, and product documentation.

    Ordering Information

    Before placing an order, customers are encouraged to confirm:

    1. Required quantity
    2. Required specification or purity
    3. Packaging requirements
    4. Destination country or region
    5. Required quality documentation
    6. Storage requirements
    7. Applicable regulatory requirements

    Product availability, specification, packaging, MOQ, lead time, and documentation are subject to confirmation based on the actual batch and order requirements.

    Important Notice

    Teriparatide 10mg is supplied for permitted research and laboratory purposes only.

    The information provided on this product page should not be interpreted as a recommendation or authorization for human or animal administration.

    No therapeutic, medical, health, or performance claims are made in this listing.

    Customers are responsible for ensuring that their intended use complies with applicable laws, regulations, institutional requirements, and internal safety procedures.

    Product specifications should be verified against the actual batch documentation before use.

    If specific regulatory controls apply in the destination market, the buyer is responsible for confirming and satisfying the applicable requirements before purchase or importation.

    Product Information Accuracy

    Product information should accurately reflect the material being supplied. Technical details such as purity, formulation, appearance, storage conditions, analytical specifications, and packaging should only be stated when supported by authentic product documentation.

    For this listing, the confirmed information is:

    Product Name: Teriparatide
    Net Content: 10 mg
    Packaging: 10 mg/vial

    Additional technical parameters should be entered only according to the actual product specification and COA.

    This listing is designed to provide a factual and professional description of the research material while avoiding unsupported claims, medical promotion, or misleading representations.

    Recommended ECHEMI Fields

    • Product Name: Teriparatide 10mg Research Material
    • Net Content: 10mg
    • Packaging: 10mg/vial
    • Application: Research and Laboratory Use
    • Purity: Fill in according to actual COA
    • CAS No.: Only enter after verification
    • Molecular Formula: Only enter after verification
    • Molecular Weight: Only enter after verification
    • Appearance: According to actual product documentation
    • Brand: Only enter the genuine manufacturer/brand
    Items Specifications
    Product Name

    Teriparatide

    Grade Research Grade
    Package 10mg/Vial
    Appearance White Lyophilized Powder
    Model

    Teriparatide 10mg

    Brand Generic

    Shop Retatrutide 15mg High Purity Peptide Research Compound Powder Product-Detailed Image 1

    Shop Retatrutide 15mg High Purity Peptide Research Compound Powder Product-Detailed Image 2
    Shop Retatrutide 15mg High Purity Peptide Research Compound Powder Product-Detailed Image 3
    Shop Retatrutide 15mg High Purity Peptide Research Compound Powder Product-Detailed Image 4
    Shop Retatrutide 15mg High Purity Peptide Research Compound Powder Product-Detailed Image 5
    Shop Retatrutide 15mg High Purity Peptide Research Compound Powder Product-Detailed Image 6
    Shop Retatrutide 15mg High Purity Peptide Research Compound Powder Product-Detailed Image 7
    Shop Retatrutide 15mg High Purity Peptide Research Compound Powder Product-Detailed Image 8
    Shop Retatrutide 15mg High Purity Peptide Research Compound Powder Product-Detailed Image 9
    Shop Retatrutide 15mg High Purity Peptide Research Compound Powder Product-Detailed Image 10
    ECHEMI Editorial Reference
    The anabolic drug teriparatide acetate (TA), known as recombinant human parathyroid hormone 1–34, which directly promotes bone formation by generating new osteocytes, has been introduced as a novel therapeutic agent for osteoporosis. Distinct from antiresorptive drug treatment, patients with osteonecrosis of the jaw showed successful clinical outcomes after weekly administration of TA. In addition, adverse outcomes of long-term bisphosphonate treatment, such as bone fracture, were healed after usage of TA, and better bone mass and mineral density improvements at the lumbar spine and femoral neck were achieved with TA treatment than with bisphosphonate treatment[1].
    Teriparatide is a recombinantform of parathyroid hormone, which is used for the treatmentof osteoporosis in men and postmenopausal women.The N-terminal region possesses 34 amino acids, which areidentical to the biologically active region of the 84-aminoacid sequence of human parathyroid hormone. It has beenshown to act on osteoblasts to stimulate new bone growthand improve bone density.
    Parathyroid Hormone Human Synthetic (C181H291N55O51S2) contains 34 amino acids and has a molecular mass of 4117.72 Dalton.The PTH is purified by proprietary chromatographic techniques.
    Research & Reference Note

    Teriparatide 10mg Research Material, Peptide Powder for Laboratory Use is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals

    Certificates
    • Teriparatide 10mg Research Material, Peptide Powder for Laboratory Use Certificates 1 TDS

    Basic Info
    Product Name:

    Teriparatide acetate

    Other Name:

    PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF;SER-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE

    CAS No.:

    52232-67-4

    Molecular Formula:

    C172H278N52O47S2

    InChIKeys:

    BUUKFBVDKSFMHN-LKMAISLMSA-N

    Molecular Weight:

    3890.49792

    EC Number:

    640-978-1

    Color/Form:

    White to Off-White

    HScode:

    2937190000

    Characteristics
    Melting Point:

    >205oC (dec.)

    Water Solubility:

    Soluble to 0.40 mg/ml in water

    Critical Temperature & Pressure:

    −20°C

    Hazard Identification

    Classification of the substance or mixture

    Carcinogenicity, Category 2

    Reproductive toxicity, Category 2

    GHS label elements, including precautionary statements

    Pictogram(s)
    Signal word

    Warning

    Hazard statement(s)

    H351 Suspected of causing cancer

    H361 Suspected of damaging fertility or the unborn child

    Precautionary statement(s)
    Prevention

    P203 Obtain, read and follow all safety instructions before use.

    P280 Wear protective gloves/protective clothing/eye protection/face protection/hearing protection/...

    Response

    P318 IF exposed or concerned, get medical advice.

    Storage

    P405 Store locked up.

    Disposal

    P501 Dispose of contents/container to an appropriate treatment and disposal facility in accordance with applicable laws and regulations, and product characteristics at time of disposal.

    Other hazards which do not result in classification

    no data available

    Handling and Storage

    Precautions for safe handling

    Handling in a well ventilated place. Wear suitable protective clothing. Avoid contact with skin and eyes. Avoid formation of dust and aerosols. Use non-sparking tools. Prevent fire caused by electrostatic discharge steam.

    Conditions for safe storage, including any incompatibilities

    Store the container tightly closed in a dry, cool and well-ventilated place. Store apart from foodstuff containers or incompatible materials.

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Peptides

    Location:

    Y17, Room 310, East Third Floor, No. 64 and 66 Jianzhong Road, Tianhe District, Guangzhou City

    Payment Terms:

    TT against copy of documents,100% TT in advance

    Average lead Time:

    1

    Total Employees:

    11-50

    Year of Establishment:

    2026

    Founded in 2024, PGpeptides is a specialized supplier of high-purity
    research peptides serving the global scientific community. With deep
    industry expertise, we deliver consistent product quality, competitive
    pricing, and flexible service tailored to research institutions, laboratories,
    and distributors worldwide.
    Our operations span North America, Europe, Asia, Australia, and the
    Middle East, backed by a mature international trade infrastructure and a
    reliable global fulfillment network. We have earned strong recognition 
    and trust across the markets we serve.
  • Inquiry History
    10 Inquiries
    Country Product Purchase Quantity Date Posted
    United States

    Teriparatide

    1 KG May 28, 2026
    Russia

    teriparatide

    100 MG Feb 23, 2026
    Kazakstan

    Teriparatide

    1 KG Jan 4, 2026
    Kazakstan

    Teriparatide

    5 MG Jan 1, 2026
    Kazakstan

    teriparatide

    1 KG Nov 17, 2025
    Germany

    Teriparatide Acetate

    5 MG Jul 5, 2026
    United States

    Teriparatide

    10 MT May 29, 2026
    Bulgaria

    teripatatide

    May 17, 2026
    Kazakstan

    Teriparatide

    5 MG Jan 2, 2026
    United Kingdom

    Supply

    Mar 5, 2024
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.