Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Skeletal Muscle Relaxants > Teriparatide acetate for Sale > Teriparatide A pureza atinge mais de 99%, e todos os produtos foram testados.
Teriparatide A pureza atinge mais de 99%, e todos os produtos foram testados. buy - large image1
Teriparatide A pureza atinge mais de 99%, e todos os produtos foram testados. buy - image1
Teriparatide A pureza atinge mais de 99%, e todos os produtos foram testados. buy - image2
Teriparatide A pureza atinge mais de 99%, e todos os produtos foram testados. buy - image3
Teriparatide A pureza atinge mais de 99%, e todos os produtos foram testados. buy - image4
Teriparatide A pureza atinge mais de 99%, e todos os produtos foram testados. buy - image5
Teriparatide A pureza atinge mais de 99%, e todos os produtos foram testados. buy - image6

Teriparatide A pureza atinge mais de 99%, e todos os produtos foram testados.

TDS 15 Inquiries

Unit Price:

$33-36/UNIT FOB

Get Latest Price
CAS No.:

52232-67-4

Grade:

Pharmaceutical Grade

Content:

99%

Port:

shanghai

Brand:

JL

Packaging:

10ml

Sample Available:

Yes

Price valid (until):

2027-10-20

Company Type:
Trader
Location:
China
Average Lead Time:
15 days
Qualification:
Main Products:

Peptide

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


    WhatsAPP:+85264811447


    Premium Quality for Research, Development, and Industrial Applications
    As a trusted global supplier, we provide a comprehensive range of high-purity peptides and biochemical compounds to support scientific innovation and product development. Our portfolio is designed for researchers, formulators, and manufacturers who require reliable, high-quality materials
    Shop Semaglutide Cartridge only,no pen included-Detailed Image 1
    Shop Semaglutide Cartridge only,no pen included-Detailed Image 2
    Shop Semaglutide Cartridge only,no pen included-Detailed Image 3

    About Product

    Appearance: Powder

    Purity: >99% (or refer to the Certificate of Analysis)

    Shipping Condition: Shipped under ambient temperature as non-hazardous chemical. This product is stable enough for a few weeks during ordinary shipping and time spent in Customs.

    Storage Condition: Dry, dark and at 0 - 4 C for short term (days to weeks) or -20 C for long term (months to years).

    Solubility: To be determined

    Shelf Life: >2 years if stored properly

    Drug Formulation: To be determined

    Stock Solution Storage: 0 - 4 C for short term (days to weeks), or -20 C for long term (months).

    Peptide Storage Guidelines: General Tips

    When storing peptides, remember to:

    • Store peptide in a cold, dry, dark place
    • Avoid repeated freezing and thawing of peptide
    • Avoid overexposure to the air
    • Avoid light exposure
    • Avoid storing peptides in solution long term
    • Aliquot peptide according to experimental requirements

    Shop Semaglutide Cartridge only,no pen included-Detailed Image 4

    Shop Semaglutide Cartridge only,no pen included-Detailed Image 5
    Shop Semaglutide Cartridge only,no pen included-Detailed Image 6
    Factory Footage
    Shop Semaglutide Cartridge only,no pen included-Detailed Image 7
    Shop Semaglutide Cartridge only,no pen included-Detailed Image 8
    Shop Semaglutide Cartridge only,no pen included-Detailed Image 9 Shop Semaglutide Cartridge only,no pen included-Detailed Image 10 Shop Eloralintide 10mg 20mg vial New Products Factory Wholesale Price High Quality Lyophilized Powder Peptide-Detailed Image 11 Shop Eloralintide 10mg 20mg vial New Products Factory Wholesale Price High Quality Lyophilized Powder Peptide-Detailed Image 12

    Why Source From Us?
    Uncompromised Quality & Verification: Every product is accompanied by comprehensive analytical documentation, including Certificates of Analysis (CoA) with HPLC purity data and Mass Spec (MS) confirmation, ensuring identity, purity (>98% typical), and batch-to-batch consistency.
    Research & Industry Focus: Our products serve the specific needs of R&D laboratories, pre-clinical studies, and commercial manufacturing for nutraceutical, cosmetic, and biotech applications.
    Supply Chain Reliability: We ensure secure, discreet, and temperature-controlled global shipping with reliable logistics partners to deliver your materials intact and on time.
    Customization & Scale: We offer flexibility from small-scale research quantities to large-volume bulk supply. Custom blending, specific purities, and private labeling are available for qualified partners.


    Frequently Asked Questions (FAQs)
    Q1: What documentation do you provide to verify product quality?
    A1: We provide a full Certificate of Analysis (CoA) for all products. For peptides, this includes HPLC purity chromatograms and Mass Spectrometry (MS) reports. For compounds like Botulinum Toxin or Cerebrolysin, we provide manufacturer-specific potency and quality control data. This ensures you receive precisely what you order.

    Q2: How are the peptides and blends formulated and shipped?
    A2: Peptides are typically supplied as sterile, lyophilized (freeze-dried) powders in sealed vials for maximum stability. Our proprietary blends (e.g., GLOW series) are precisely weighed and mixed under controlled conditions. All sensitive items are shipped with cold packs in insulated containers to maintain integrity.

    Q3: What is the typical lead time and minimum order quantity (MOQ)?
    A3: For standard in-stock items, lead time is 3-7 business days after order confirmation. MOQ varies by product but starts as low as 10 vial for many research peptides. We offer significant discounts for bulk and recurring commercial orders. Contact us directly for a specific quote.

    Q4: Can you create custom peptide blends or provide specific analogs?
    A4: Yes. Custom synthesis and blending are a core part of our service. We can develop tailored peptide combinations, specific concentrations, or modified analogs to meet your unique research or product development needs. Submit your specifications for a prompt consultation and quote.

    ECHEMI Editorial Reference
    The anabolic drug teriparatide acetate (TA), known as recombinant human parathyroid hormone 1–34, which directly promotes bone formation by generating new osteocytes, has been introduced as a novel therapeutic agent for osteoporosis. Distinct from antiresorptive drug treatment, patients with osteonecrosis of the jaw showed successful clinical outcomes after weekly administration of TA. In addition, adverse outcomes of long-term bisphosphonate treatment, such as bone fracture, were healed after usage of TA, and better bone mass and mineral density improvements at the lumbar spine and femoral neck were achieved with TA treatment than with bisphosphonate treatment[1].
    Teriparatide is a recombinantform of parathyroid hormone, which is used for the treatmentof osteoporosis in men and postmenopausal women.The N-terminal region possesses 34 amino acids, which areidentical to the biologically active region of the 84-aminoacid sequence of human parathyroid hormone. It has beenshown to act on osteoblasts to stimulate new bone growthand improve bone density.
    Parathyroid Hormone Human Synthetic (C181H291N55O51S2) contains 34 amino acids and has a molecular mass of 4117.72 Dalton.The PTH is purified by proprietary chromatographic techniques.

    Certificates
    • Teriparatide A pureza atinge mais de 99%, e todos os produtos foram testados. Certificates 1 TDS

    Basic Info
    Product Name:

    Teriparatide acetate

    Other Name:

    PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF;SER-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE

    CAS No.:

    52232-67-4

    Molecular Formula:

    C172H278N52O47S2

    InChIKeys:

    BUUKFBVDKSFMHN-LKMAISLMSA-N

    Molecular Weight:

    3890.49792

    EC Number:

    640-978-1

    Color/Form:

    White to Off-White

    HScode:

    2937190000

    Characteristics
    Melting Point:

    >205oC (dec.)

    Water Solubility:

    Soluble to 0.40 mg/ml in water

    Critical Temperature & Pressure:

    −20°C

    Hazard Identification

    Classification of the substance or mixture

    Carcinogenicity, Category 2

    Reproductive toxicity, Category 2

    GHS label elements, including precautionary statements

    Pictogram(s)
    Signal word

    Warning

    Hazard statement(s)

    H351 Suspected of causing cancer

    H361 Suspected of damaging fertility or the unborn child

    Precautionary statement(s)
    Prevention

    P203 Obtain, read and follow all safety instructions before use.

    P280 Wear protective gloves/protective clothing/eye protection/face protection/hearing protection/...

    Response

    P318 IF exposed or concerned, get medical advice.

    Storage

    P405 Store locked up.

    Disposal

    P501 Dispose of contents/container to an appropriate treatment and disposal facility in accordance with applicable laws and regulations, and product characteristics at time of disposal.

    Other hazards which do not result in classification

    no data available

    Handling and Storage

    Precautions for safe handling

    Handling in a well ventilated place. Wear suitable protective clothing. Avoid contact with skin and eyes. Avoid formation of dust and aerosols. Use non-sparking tools. Prevent fire caused by electrostatic discharge steam.

    Conditions for safe storage, including any incompatibilities

    Store the container tightly closed in a dry, cool and well-ventilated place. Store apart from foodstuff containers or incompatible materials.

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Peptide

    Location:

    zhejiangshengjinhuashiyiwushijiangdongjiedaodongnanlu656hao

    Average lead Time:

    15 days

    Total Annual Revenue:

    $1 million-$2.5 million

    Total Employees:

    5-10

    Year of Establishment:

    2026

    Jielu Trading focuses on the global cross‑border supply chain of high‑end peptide raw materials. Rooted in cutting‑edge biotechnology, we specialize in the selection, quality control, trade and globalized services of peptide products.

    Adhering to strict quality standards and raw material traceability systems, we provide high‑purity and stable peptide raw materials as well as integrated supply‑chain solutions for scientific research, health care and medical aesthetics industries with standardized production and complete compliance qualifications.

    Guided by our brand philosophy With Peptide Power, Integrity Leads Far, Empowering the World, Jielu builds a stable and efficient global trade network with craftsmanship, integrity and global vision. We strive to be an influential benchmark service provider in the worldwide peptide industry, and create a brighter future with global partners.

  • Inquiry History
    15 Inquiries
    Country Product Purchase Quantity Date Posted
    United States

    Teriparatide

    1 KG May 28, 2026
    United States

    Teriparatide

    10 MT May 29, 2026
    Bulgaria

    teripatatide

    May 17, 2026
    Russia

    teriparatide

    100 MG Feb 23, 2026
    Kazakstan

    Teriparatide

    5 MG Jan 2, 2026
    Kazakstan

    Teriparatide

    5 MG Jan 1, 2026
    Kazakstan

    teriparatide

    1 KG Nov 17, 2025
    United Kingdom

    Supply

    Mar 5, 2024
    United States

    teriparatide

    1 G Sep 6, 2026
    Kazakstan

    Teriparatide

    1 KG Jan 4, 2026
    Russia

    Teriparatide

    1 G Sep 12, 2026
    Russia

    Teriparatide

    1 G Sep 12, 2026
    United States

    Teriparatide kit of 10 2mg vials

    1 MT Sep 7, 2026
    Germany

    Teriparatide Acetate

    5 MG Jul 5, 2026
    Belgium

    Erdafitinib

    10 G Sep 20, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.