Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > SS-31 Peptide High Purity Powder for Research and Development
SS-31 Peptide High Purity Powder for Research and Development buy - large image1
SS-31 Peptide High Purity Powder for Research and Development buy - image1
SS-31 Peptide High Purity Powder for Research and Development buy - image2
SS-31 Peptide High Purity Powder for Research and Development buy - image3
SS-31 Peptide High Purity Powder for Research and Development buy - image4
SS-31 Peptide High Purity Powder for Research and Development buy - image5
SS-31 Peptide High Purity Powder for Research and Development buy - image6

SS-31 Peptide High Purity Powder for Research and Development

TDS 3 Inquiries

Unit Price:

$40/UNIT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Research Grade

Content:

99%

Port:

深圳

Brand:

XH

Packaging:

10mg/vial10vial/kit

Price valid (until):

2026-10-02

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Peptides

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


    Contact Information   


    Sales Manager Name: Airs
    WhatsApp Number: +852 5531 1275
    Email Address: meslane07@163.com

    SS-31 Peptide High Purity Research Material for Laboratory Applications

    SS-31 is a synthetic peptide material supplied for research laboratories, analytical laboratories, and related scientific applications. The product is manufactured with attention to raw material control, production procedures, purification, packaging, and quality documentation.

    We understand that research customers require reliable and consistent materials. Therefore, our quality management process focuses on product identity, purity specifications, batch consistency, and proper packaging. Relevant analytical documentation can be supplied according to the product specification and customer requirements.

    The product is available for researchers, laboratories, distributors, and professional buyers looking for a reliable source of synthetic peptide materials. We can support different order quantities and packaging requirements, making the product suitable for both laboratory-scale research and larger procurement projects.

    Our team can provide product specifications and technical information for customer evaluation. For bulk orders, we can also discuss customized packaging, labeling, and other commercial requirements.

    Key Product Information:

    • Product: SS-31
    • Product Type: Synthetic Peptide
    • Grade: Research Grade
    • Application: Laboratory Research / Analytical Research
    • Packaging: Customized options available
    • Documentation: Product specifications and analytical documents available where applicable
    • Supply: Small quantity and bulk orders supported

    Notice: SS-31 is supplied for research and analytical purposes only. It is not intended for human consumption, medical use, diagnosis, treatment, or prevention of any disease.


    Shop 5-Amino-1MQ 10mg High Purity Powder Chemical Ingredient for Laboratory Research Use-Detailed Image 2
    Shop 5-Amino-1MQ 10mg High Purity Powder Chemical Ingredient for Laboratory Research Use-Detailed Image 3
    Shop 5-Amino-1MQ 10mg High Purity Powder Chemical Ingredient for Laboratory Research Use-Detailed Image 4
    Shop 5-Amino-1MQ 10mg High Purity Powder Chemical Ingredient for Laboratory Research Use-Detailed Image 5
    Shop 5-Amino-1MQ 10mg High Purity Powder Chemical Ingredient for Laboratory Research Use-Detailed Image 6
    Shop 5-Amino-1MQ 10mg High Purity Powder Chemical Ingredient for Laboratory Research Use-Detailed Image 7


    Product Detail  You might be interested in these


    1. Can we get free samples?
    We can provide free samples for testing, but the buyer is responsible for the shipping costs.
    2. Can we print designs or apply labels to the bottles?
    We offer various printing methods, such as screen printing, hot stamping, and label printing.
    3. What is the standard lead time?
    In-stock items will be shipped within 24–48 hours of receiving payment.
    Custom-colored bottles will be shipped within 3–5 days.
    4. What are your shipping terms?
    We offer sea and air shipping, as well as courier services such as FedEx, DHL, UPS, and TNT.
    5. How does your factory handle quality control?
    We conduct three rounds of testing before packaging. If any quality issues—such as breakage—arise after delivery, we will handle the after-sales service.


    Shop 5-Amino-1MQ 10mg High Purity Powder Chemical Ingredient for Laboratory Research Use-Detailed Image 8
    Shop 5-Amino-1MQ 10mg High Purity Powder Chemical Ingredient for Laboratory Research Use-Detailed Image 9
    Shop 5-Amino-1MQ 10mg High Purity Powder Chemical Ingredient for Laboratory Research Use-Detailed Image 10
    Shop 5-Amino-1MQ 10mg High Purity Powder Chemical Ingredient for Laboratory Research Use-Detailed Image 11

    Pls input...

    ECHEMI Editorial Reference
    LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.

    Certificates

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

    Research
    Class:

    Mitochondria-targeted tetrapeptide (Szeto-Schiller peptide)

    Status:

    FDA-approved (Forzinity) — Accelerated Approval 2025

    Mechanism:

    A cell-permeable, synthetic tetrapeptide (D-Arg-Dmt-Lys-Phe-NH₂) that selectively concentrates in the inner mitochondrial membrane and reversibly binds to cardiolipin, a phospholipid essential for electron transport chain (ETC) function. By stabilizing cardiolipin, SS-31 restores mitochondrial bioenergetics, reduces cytochrome c peroxidase activity, and prevents oxidative damage in cells with impaired mitochondrial function.

    Activity note:

    SS-31 does not act via traditional receptor agonism. It binds cardiolipin with high selectivity in the inner mitochondrial membrane. Functional EC₅₀ values are context-dependent (cell type, stress model). Key electrophysiology studies report mitochondrial membrane potential restoration at nanomolar concentrations.

    Source:

    Szeto HH, et al. AAPS J. 2006;8(2):E277-E283. Birk AV, et al. J Am Soc Nephrol. 2014;25(6):1157-1169.DOI

    Clinical Development:

    NCT03098797; NCT02814097; NCT02976038; NCT03354065

    FDA:

    Forzinity (approved 2025-09-19)

    References
    ChEMBL:

    CHEMBL3833370

    DrugBank:

    DB11981

    KEGG DRUG:

    D10925

    PubChem:

    PubChem

    Disclaimer:

    Elamipretide (Forzinity) is FDA-approved under accelerated approval for Barth syndrome. This listing is for industrial and laboratory research use only. Research-chemical listings on B2B marketplaces are not interchangeable with approved medicines. Confirm CAS, specification, and regulatory pathway with the seller. It is not medical advice, a clinical recommendation, or an approved therapy description.

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Peptides

    Location:

    Y17, Room 310, East Third Floor, No. 64 and 66 Jianzhong Road, Tianhe District, Guangzhou City

    Payment Terms:

    TT against copy of documents,100% TT in advance

    Average lead Time:

    1

    Total Employees:

    11-50

    Year of Establishment:

    2026

    Founded in 2024, PGpeptides is a specialized supplier of high-purity
    research peptides serving the global scientific community. With deep
    industry expertise, we deliver consistent product quality, competitive
    pricing, and flexible service tailored to research institutions, laboratories,
    and distributors worldwide.
    Our operations span North America, Europe, Asia, Australia, and the
    Middle East, backed by a mature international trade infrastructure and a
    reliable global fulfillment network. We have earned strong recognition 
    and trust across the markets we serve.
  • Inquiry History
    3 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.