Product
Supplier
Encyclopedia
Inquiry
Home > Biochemical Engineering > Polypeptide > LL-37 for Sale > LL37 LL-37 CAS 154947-66-7 99% Purity Peptide Lyophilized Powder Factory Supply
LL37 LL-37 CAS 154947-66-7 99% Purity Peptide Lyophilized Powder Factory Supply buy - large image1
LL37 LL-37 CAS 154947-66-7 99% Purity Peptide Lyophilized Powder Factory Supply buy - image1
LL37 LL-37 CAS 154947-66-7 99% Purity Peptide Lyophilized Powder Factory Supply buy - image2
LL37 LL-37 CAS 154947-66-7 99% Purity Peptide Lyophilized Powder Factory Supply buy - image3
LL37 LL-37 CAS 154947-66-7 99% Purity Peptide Lyophilized Powder Factory Supply buy - image4

LL37 LL-37 CAS 154947-66-7 99% Purity Peptide Lyophilized Powder Factory Supply

TDS 3 Inquiries

Unit Price:

$90/UNIT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Research Grade

Content:

99%

Port:

HK

Brand:

hnkunyao

Packaging:

5mg/vial

Price valid (until):

2026-12-31

Company Type:
Trader
Location:
China
Qualification:
Main Products:

PEPTIDES

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Contact information  


    Whatsapp:+852 7098 4722 

    WeChat:+86 188 300 14627

    Mailbox: kyemi01che@163.com


    Our service  


    1. We supply peptides, APIs and intermediates to meet your needs;
    2. We will reply to your inquiry within 24 hours;
    3. Strictly select raw materials. Our Q&A team will strictly check the quality of each product before delivery;
    4. Reasonable and competitive price and fast delivery time;
    After delivery, we will help you track it every two days until you receive the product. When you receive the goods, if you have any questions, please contact us and we will provide you with a solution;
    6. 100% safe delivery and guaranteed delivery.


      Company profile  


    Focus on the research and development, production and customized services of high-quality peptides. With excellent technical strength and strict quality control system, the company provides reliable peptide products and solutions for scientific research institutions, pharmaceutical enterprises and biotechnology enterprises around the world.
    Strong ability to lay the foundation of quality.
    Advanced technology platform: equipped with internationally advanced peptide synthesis equipment and purification system, adopting cutting-edge technologies such as solid-phase synthesis (SPPS) and liquid-phase synthesis, it can support research and development from mg to kg, and ensure high purity and activity of products.
    Strict quality control: following the ISO 9001 quality management system, each batch of products has undergone multidimensional tests, including high performance liquid chromatography (HPLC) and mass spectrometry (MS), and complete quality inspection reports are provided to ensure the quality traceability of the whole production process.
    Efficient customized service: It has a professional R&D team, which can quickly respond to customers' needs, support complex sequence synthesis, customize modified peptide segments (such as phosphorylation, fluorescence labeling, polyethylene glycol modification, etc.), and provide one-stop service from solution design to delivery.


    Payment


    Shop Retatrutide LY-3437943 CAS 2381089-83-2 High Purity Synthetic Peptide Research Grade-Detailed Image 1 Shop Retatrutide LY-3437943 CAS 2381089-83-2 High Purity Synthetic Peptide Research Grade-Detailed Image 2 Shop Retatrutide LY-3437943 CAS 2381089-83-2 High Purity Synthetic Peptide Research Grade-Detailed Image 3 Shop Retatrutide LY-3437943 CAS 2381089-83-2 High Purity Synthetic Peptide Research Grade-Detailed Image 4 Shop Retatrutide LY-3437943 CAS 2381089-83-2 High Purity Synthetic Peptide Research Grade-Detailed Image 5


      FQA  


    Q: How to store it?
    Answer: If it has not been opened, put it in a cool and dry place; If opened, it can be refrigerated to 2-5 degrees.
    Q: How do I order this product?
    A: You can click "Contact Supplier", or send an email to my inbox, send a consultation, leave a message if possible, and we will contact you as soon as possible, and then discuss the details of the order.
    Q: What is the delivery time?
    A: Delivery will be made within 48 hours after receipt of payment. Small orders are delivered by express delivery. The goods will arrive in about 7 to 10 days.
    Q: Is it cash on delivery?
    A: In most cases, we don't support cash on delivery.
    Q: What is the price of the goods?
    A: As we all know, the price of chemicals is not fixed, but fluctuates with the market.
    You need to contact me to get the latest product price, and we guarantee to provide you with the most favorable price.
    Q: About after-sales service?
    A: After purchasing our products, we have a professional technical team and after-sales team to serve you and solve all your future problems.


      Product Detail  







    Name: LL37 5mg
    Purity: >99% (or refer to the Certificate of Analysis)
    Storage Condition: Dry, dark and at 0 - 4 C for short term (days to weeks) or -20 C for long term (months to years).
    Shelf Life: >2 years if stored properly Stock Solution Storage: 0 - 4 C for short term (days to weeks), or -20 C for long term (months). LL‑37 is the only human cathelicidin antimicrobial peptide, derived from the hCAP18 protein. It is a 37‑amino acid cationic, amphipathic α‑helical peptide with broad immunomodulatory and host defense functions.
    It exhibits potent antimicrobial activity against Gram‑positive and Gram‑negative bacteria, fungi, and enveloped viruses. Beyond direct microbial killing, LL‑37 regulates inflammation, promotes wound healing, modulates immune cell recruitment, and supports tissue repair. It is widely studied in immunology, dermatology, infection research, and mucosal defense.
    Production:
    Manufactured via solid-phase peptide synthesis (SPPS), followed by purification and lyophilization to obtain the final product.
    NOTE: This product was prepared by chemical synthesis. Used only for research. Not for human use.

    Product name

    LL37 5mg

    CAS NO 154947-66-7
    Storage Dry powder: Store at -20℃;After reconstitution store at 2°C‑8°C
    Purity ≥99%


      Product detail drawing  


    Shop LL37 LL-37 CAS 154947-66-7 99% Purity Peptide Lyophilized Powder Factory Supply-Detailed Image 6 Shop LL37 LL-37 CAS 154947-66-7 99% Purity Peptide Lyophilized Powder Factory Supply-Detailed Image 7 Shop LL37 LL-37 CAS 154947-66-7 99% Purity Peptide Lyophilized Powder Factory Supply-Detailed Image 8 Shop LL37 LL-37 CAS 154947-66-7 99% Purity Peptide Lyophilized Powder Factory Supply-Detailed Image 9



      Transportation and packaging  


    Shop Retatrutide LY-3437943 CAS 2381089-83-2 High Purity Synthetic Peptide Research Grade-Detailed Image 10 Shop Retatrutide LY-3437943 CAS 2381089-83-2 High Purity Synthetic Peptide Research Grade-Detailed Image 11


      Factory details


    Shop LL37 LL-37 CAS 154947-66-7 99% Purity Peptide Lyophilized Powder Factory Supply-Detailed Image 12 Shop LL37 LL-37 CAS 154947-66-7 99% Purity Peptide Lyophilized Powder Factory Supply-Detailed Image 13 Shop LL37 LL-37 CAS 154947-66-7 99% Purity Peptide Lyophilized Powder Factory Supply-Detailed Image 14 Shop LL37 LL-37 CAS 154947-66-7 99% Purity Peptide Lyophilized Powder Factory Supply-Detailed Image 15

    ECHEMI Editorial Reference
    LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.
    Research & Reference Note

    LL37 LL-37 CAS 154947-66-7 99% Purity Peptide Lyophilized Powder Factory Supply is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals

    Certificates
    • LL37 LL-37 CAS 154947-66-7 99% Purity Peptide Lyophilized Powder Factory Supply Certificates 1 TDS

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Polypeptide

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    PEPTIDES

    Location:

    Room 305, 3rd Floor, Unit 2, Building 48, Datangxia Zone 2, Choucheng Subdistrict, Yiwu, Jinhua, Zhejiang Province, China

    Year of Establishment:

    2026

  • Inquiry History
    3 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.