Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > Semax Peptide High Purity Research Grade Raw Material
Semax Peptide High Purity Research Grade Raw Material buy - large image1
Semax Peptide High Purity Research Grade Raw Material buy - image1
Semax Peptide High Purity Research Grade Raw Material buy - image2
Semax Peptide High Purity Research Grade Raw Material buy - image3
Semax Peptide High Purity Research Grade Raw Material buy - image4
Semax Peptide High Purity Research Grade Raw Material buy - image5
Semax Peptide High Purity Research Grade Raw Material buy - image6

Semax Peptide High Purity Research Grade Raw Material

TDS 3 Inquiries

Unit Price:

$20/UNIT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Research Grade

Content:

99%

Port:

深圳

Brand:

XH

Packaging:

5mg/vial10vial/kit

Price valid (until):

2026-10-03

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Peptides

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


    Contact Information   


    Sales Manager Name: Airs
    WhatsApp Number: +852 5531 1275
    Email Address: meslane07@163.com

    High Purity Semax Peptide for Laboratory Research

    Semax is a synthetic peptide material offered as a research-grade product for laboratory and analytical applications. It is supplied as a carefully processed powder with a focus on purity, consistency, and batch-to-batch quality control.

    The product is suitable for customers who require peptide materials for professional research projects and laboratory analysis. We provide flexible packaging options and support bulk orders according to customer requirements.

    Product Information

    • Name: Semax

    • Product Type: Synthetic Peptide

    • Physical Form: Powder

    • Appearance: White or off-white powder

    • Purity: ≥99%*

    • Packaging: Various sizes available

    • Storage Condition: Cool, dry and sealed storage recommended

    • Intended Use: Research and analytical use only

    Quality & Supply

    Quality control is performed throughout the production and packaging process. Product specifications, batch information and supporting documentation can be provided according to order requirements.

    With stable production capacity and flexible order quantities, we aim to provide reliable supply for international customers. Please contact us for detailed specifications, available packaging, lead time and quotation.

    *Actual specifications are subject to the corresponding batch documentation.


    Shop 5-Amino-1MQ 10mg High Purity Powder Chemical Ingredient for Laboratory Research Use-Detailed Image 2
    Shop 5-Amino-1MQ 10mg High Purity Powder Chemical Ingredient for Laboratory Research Use-Detailed Image 3
    Shop 5-Amino-1MQ 10mg High Purity Powder Chemical Ingredient for Laboratory Research Use-Detailed Image 4
    Shop 5-Amino-1MQ 10mg High Purity Powder Chemical Ingredient for Laboratory Research Use-Detailed Image 5
    Shop 5-Amino-1MQ 10mg High Purity Powder Chemical Ingredient for Laboratory Research Use-Detailed Image 6
    Shop 5-Amino-1MQ 10mg High Purity Powder Chemical Ingredient for Laboratory Research Use-Detailed Image 7


    Product Detail  You might be interested in these


    1. Can we get free samples?
    We can provide free samples for testing, but the buyer is responsible for the shipping costs.
    2. Can we print designs or apply labels to the bottles?
    We offer various printing methods, such as screen printing, hot stamping, and label printing.
    3. What is the standard lead time?
    In-stock items will be shipped within 24–48 hours of receiving payment.
    Custom-colored bottles will be shipped within 3–5 days.
    4. What are your shipping terms?
    We offer sea and air shipping, as well as courier services such as FedEx, DHL, UPS, and TNT.
    5. How does your factory handle quality control?
    We conduct three rounds of testing before packaging. If any quality issues—such as breakage—arise after delivery, we will handle the after-sales service.


    Shop 5-Amino-1MQ 10mg High Purity Powder Chemical Ingredient for Laboratory Research Use-Detailed Image 8
    Shop 5-Amino-1MQ 10mg High Purity Powder Chemical Ingredient for Laboratory Research Use-Detailed Image 9
    Shop 5-Amino-1MQ 10mg High Purity Powder Chemical Ingredient for Laboratory Research Use-Detailed Image 10
    Shop 5-Amino-1MQ 10mg High Purity Powder Chemical Ingredient for Laboratory Research Use-Detailed Image 11

    Pls input...

    ECHEMI Editorial Reference
    LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.
    Research & Reference Note

    Semax Peptide High Purity Research Grade Raw Material is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals

    Certificates

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Peptides

    Location:

    Y17, Room 310, East Third Floor, No. 64 and 66 Jianzhong Road, Tianhe District, Guangzhou City

    Payment Terms:

    TT against copy of documents,100% TT in advance

    Average lead Time:

    1

    Total Employees:

    11-50

    Year of Establishment:

    2026

    Founded in 2024, PGpeptides is a specialized supplier of high-purity
    research peptides serving the global scientific community. With deep
    industry expertise, we deliver consistent product quality, competitive
    pricing, and flexible service tailored to research institutions, laboratories,
    and distributors worldwide.
    Our operations span North America, Europe, Asia, Australia, and the
    Middle East, backed by a mature international trade infrastructure and a
    reliable global fulfillment network. We have earned strong recognition 
    and trust across the markets we serve.
  • Inquiry History
    3 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.