 Home > Biochemical Engineering > Polypeptide > Glucagon for Sale > GND2, 99% high purity, direct sales from Chinese factories, fast logistics

GND2, 99% high purity, direct sales from Chinese factories, fast logistics buy - large image1

GND2, 99% high purity, direct sales from Chinese factories, fast logistics buy - image1

GND2, 99% high purity, direct sales from Chinese factories, fast logistics buy - image2

GND2, 99% high purity, direct sales from Chinese factories, fast logistics buy - image3

GND2, 99% high purity, direct sales from Chinese factories, fast logistics buy - image4

GND2, 99% high purity, direct sales from Chinese factories, fast logistics

4 Inquiries

Unit Price:

$30/G FOB

Get Latest Price 

CAS No.:

16941-32-5

Grade:

Pharmaceutical Grade

Content:

99%

Port:

Hong Kong

Packaging:

Vial/Bottle/Bag/Carton

Price valid (until):

2026-10-09

Contact Supplier

 Chat Now

Yiwu Nianwu

Company Type:

Trader

Location:

China

Qualification:

Main Products:

PEPTIDES

 Visit Store

Product Description
Seller Information
Inquiry History

Description

Sales manager:Mika
whatsapp：+447858195534

Product Name	GND2
Type	Lyophilized Powder
storage	keep in a cool,dark location in a tightly sealed container or cylinder.
CAS No	16941-32-5
Purity	>99%
Specific	2mg
Package	10 vials/box/kit

Product Detail

GND2 is a synthetic bioactive peptide. It is supplied as high-purity lyophilized powder with purity ≥99% tested by HPLC. This product is limited to laboratory in-vitro research, mainly applied in cell regulation, biochemical analysis and related biochemical experiments for research institutions and biotechnology laboratories.

Shop GND2, 99% high purity, direct sales from Chinese factories, fast logistics-Detailed Image 1

Shop GND2, 99% high purity, direct sales from Chinese factories, fast logistics-Detailed Image 2

Shop GND2, 99% high purity, direct sales from Chinese factories, fast logistics-Detailed Image 3

Shop GND2, 99% high purity, direct sales from Chinese factories, fast logistics-Detailed Image 4

FAQ

1. How to make an order?
Send me message and let me know what you need with quantity , then i will calculate to you.

2. What's the lead time and shipping ways?
We will delivery to the package by USPS, FEDEX, DHL paket and UPS express to you after receive your payment, it would take around 5-15 days to your address.

3. How do i keep the peptides when i receive it ?
Peptides in the form of lyophilized powder can be transported at room temperature by vacuum packaging, while polypeptides in the dissolved state need to be refrigerated at 2°C - 8°C. For long-term storage, peptides should be stored in the form of lyophilized powder store at -20°C or -80°C in a sealed container with desiccant, which can avoid the degradation of peptides to the greatest extent.

4. What's the payment methods ?
We could accept pay through paypal,bank transfer and bitcoin.

ECHEMI Editorial Reference

White or almost white powderProduced by the α cells of the islands of Langerhans and also by the gastric mucosa. It is opposite in effect to insulin. It appears to be a straight-chain polypeptide with a molecular weight of approximately 3500. Small amounts have been detected in commproduced by recombinant DNA technology ismarketed by Novo Nordisk (glucagon [recombinant] hydrochloride,GlucaGen HypoKit, GlucaGen Diagnostic Kit)and by Eli Lilly (glucagon [recombinant] Emergency Kit). The hypergly

Basic Info

Product Name:

Glucagon

Other Name:

GLUCAGON 1-37;GLUCAGON (1-37) (PORCINE);GLUCAGON 37;GLUCAGON ACETATE;HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA;H-HIS-SER-GLN-GLY-THR-PHE-THR-SER-ASP-TYR-SER-LYS-TYR-LEU-ASP-SER-ARG-ARG-ALA-GLN-ASP-PHE-VAL-GLN-TRP-LEU-MET-ASN-THR-LYS-ARG-ASN-LYS-ASN-ASN-ILE-ALA-OH;OXYNTOMODULIN (PORCINE);OXYNTOMODULIN

CAS No.:

16941-32-5

Molecular Formula:

C153H225N43O49S

InChIKeys:

MASNOZXLGMXCHN-ZLPAWPGGSA-N

Molecular Weight:

3482.75

Exact Mass:

3480.615723

EC Number:

232-708-2

HScode:

2937190000

Categories:

Polypeptide

Characteristics

PSA:

1564.04000

XLogP3:

-6.01

Appearance:

powder

Density:

1.53±0.1 g/cm3(Predicted)

Refractive Index:

1.682

Water Solubility:

Practically insoluble in water and in most organic solvents. It is soluble in dilute mineral acids and in dilute solutions of alkali hydroxides.

Storage Conditions:

−20°C

See More Glucagon Properties 

Hazard Identification

Classification of the substance or mixture

Skin sensitization, Category 1

Acute toxicity - Category 4, Inhalation

Respiratory sensitization, Category 1

GHS label elements, including precautionary statements

Precautionary statement(s)
Pictogram(s)
Signal word	Danger
Hazard statement(s)	H317 May cause an allergic skin reaction H332 Harmful if inhaled H334 May cause allergy or asthma symptoms or breathing difficulties if inhaled
Prevention	P261 Avoid breathing dust/fume/gas/mist/vapours/spray. P272 Contaminated work clothing should not be allowed out of the workplace. P280 Wear protective gloves/protective clothing/eye protection/face protection/hearing protection/... P271 Use only outdoors or in a well-ventilated area. P284 [In case of inadequate ventilation] wear respiratory protection.
Response	P302+P352 IF ON SKIN: Wash with plenty of water/... P333+P317 If skin irritation or rash occurs: Get medical help. P321 Specific treatment (see ... on this label). P362+P364 Take off contaminated clothing and wash it before reuse. P304+P340 IF INHALED: Remove person to fresh air and keep comfortable for breathing. P317 Get medical help. P342+P316 If experiencing respiratory symptoms: Get emergency medical help immediately.
Storage	none
Disposal	P501 Dispose of contents/container to an appropriate treatment and disposal facility in accordance with applicable laws and regulations, and product characteristics at time of disposal.

Other hazards which do not result in classification

no data available

Handling and Storage

Precautions for safe handling

Handling in a well ventilated place. Wear suitable protective clothing. Avoid contact with skin and eyes. Avoid formation of dust and aerosols. Use non-sparking tools. Prevent fire caused by electrostatic discharge steam.

Conditions for safe storage, including any incompatibilities

Store the container tightly closed in a dry, cool and well-ventilated place. Store apart from foodstuff containers or incompatible materials.

See More Glucagon Safety Data Sheet 

Seller Information

Business Type:
Trader

Main Products:
PEPTIDES

Location:
Room 305, 3rd Floor, Unit 2, Building 48, Datangxia Zone 2, Choucheng Subdistrict, Yiwu, Jinhua, Zhejiang Province, China

Year of Establishment:
2026

Inquiry History

4 Inquiries

Country	Product	Purchase Quantity	Date Posted
Belgium	Glucagon 16941-32-5 Pharmaceutical grade	10 PCS	Jan 8, 2026
Belgium	Glucagon (1-29)	5 MG	Jan 9, 2026
Netherlands	glucagon	1000 KG	Feb 15, 2024
Bulgaria	Glucagon, not retatrutide, just glucagon	1 G	May 10, 2026

Post an enquiry for this product

More Choices Find All Products for Sale 

Product Name	Grade / Content	Price	Supplier Name	Details
Glucagon Acetate 98% white powder cas 16941-32-5	Cosmetics Grade/95	$100/MT FOB	Chengdu Jinglin Biotechnology Co., Ltd.	Inquiry
Glucagon Hydrochloride	Research and Industrial Grade/98.00		Hangzhou Go Top Peptide Biotech Co.,Ltd.	Inquiry
Glucagon 16941-32-5	Reagent Grade/98	$900-1000/G FOB	cellmano peptide	Inquiry
Glucagon Acetate 98% white powder cas 16941-32-5/ Youngshe	Chemical Grade/98	$20-25/UNIT FOB	Youngshe	Inquiry
Glucagon	Pharmaceutical Grade/		zpcChina	Inquiry