Product
Supplier
Encyclopedia
Inquiry
Home > Biochemical Engineering > Polypeptide > LL-37 for Sale > High-Purity Peptide Globally Best-Selling Good price fast delivery peptide Chemical peptide CND10
High-Purity Peptide Globally Best-Selling Good price fast delivery peptide Chemical peptide CND10 buy - large image1
High-Purity Peptide Globally Best-Selling Good price fast delivery peptide Chemical peptide CND10 buy - image1
High-Purity Peptide Globally Best-Selling Good price fast delivery peptide Chemical peptide CND10 buy - image2
High-Purity Peptide Globally Best-Selling Good price fast delivery peptide Chemical peptide CND10 buy - image3
High-Purity Peptide Globally Best-Selling Good price fast delivery peptide Chemical peptide CND10 buy - image4
High-Purity Peptide Globally Best-Selling Good price fast delivery peptide Chemical peptide CND10 buy - image5
High-Purity Peptide Globally Best-Selling Good price fast delivery peptide Chemical peptide CND10 buy - image6

High-Purity Peptide Globally Best-Selling Good price fast delivery peptide Chemical peptide CND10

TDS 3 Inquiries

Unit Price:

$145-150/UNIT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

High Purity Grade

Content:

99%

Port:

Shenzhen

Brand:

Tong Peptides

Packaging:

5mg/vial, 10 vials/box

Price valid (until):

2027-03-05

Company Type:
Manufactory
Location:
China
Payment Terms:
TT against copy of documents,L/C,TT against B/L draft before shipment,100% TT in advance
Qualification:
Main Products:

retatrutide,TB-500,GHK-CU,peptide

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


    Name:Chloe

    Whatsapp:+852 6572 8571

    Email Address:chloe@tongpeptides.com

    What is CND10  ?

    CND10 is catalog designation for CND10, 10 mg per vial. Produced by solid‑phase peptide synthesis, supplied as white lyophilized powder with tested purity ≥98%.


    In laboratory studies, CND10 is applied for in‑vitro and pre‑clinical experiments including lipid transport mechanism, mitochondrial energy metabolism, hepatic lipid processing, methylation biochemical pathway and related metabolic biological‑model research. This item is lab‑grade research raw material only for biochemistry and molecular‑cell research projects. 

    Store unopened lyophilized powder at ‑20℃, keep dry and away from light. Reconstitute with 0.9% BAC bacteriostatic water. After reconstitution, store at 2‑8℃ refrigeration. Gently swirl the vial to dissolve powder, do not shake violently. Avoid repeated freeze‑thaw cycles, aliquot is recommended for dissolved solution.
    • Why choose us?
    • 1.High quality products with competitive pricing.
    • 2.Free samples available for your evaluation and testing.
    • 3.Fast, reliable delivery via reputable shipping lines.
    • 4.Trial orders are welcome for quality verification after sample approval.
    • 5.Proactive updates and full transparency at every stage of your order.
    • 6.Custom packaging solutions tailored to meet your specific requirements.

    Item

    Details

    Product Name

    CND10

    Appearance

    White Lyophilized Powder

    Purity

    ≥99%

    CAS No.

    154947-66-7

    Specification

    10mg per vial

    Storage (Unopened)

    -20℃, Keep dry and away from light

    Storage (After reconstitution)

    2-8℃ refrigerated, use within 7-12 days

    Solvent for reconstitution

    BAC water (Benzyl Alcohol 0.9%)

    Shelf life

    24 months under proper storage


    Shop High-Purity Peptide Globally Best-Selling Good price fast delivery peptide Chemical peptide CND10-Detailed Image 1

    Shop High-Purity Peptide Globally Best-Selling Good price fast delivery peptide Chemical peptide CND10-Detailed Image 2

    Shop High-Purity Peptide Globally Best-Selling Good price fast delivery peptide Chemical peptide CND10-Detailed Image 3

    Application
    CND10 is widely used in academic laboratory research, including cell activity research, fibroblast related experiments, oxidative stress mechanism, inflammatory response study, tissue repair mechanism and pre-clinical biological model research.

    FAQ
    Q1: Can you provide COA for CND10?
    A: Yes, official batch COA test report can be provided.
    Q2: What solvent is suitable for reconstitution?
    A: We recommend 0.9% BAC bacteriostatic water for best solubility and activity retention.
    Q3: How long can reconstituted CND10 be stored?
    A: 2-8℃ refrigerated storage, valid for 7-10 days after dissolving.

    Shop High-Purity Peptide Globally Best-Selling Good price fast delivery peptide Chemical peptide CND10-Detailed Image 4

    Shop High-Purity Peptide Globally Best-Selling Good price fast delivery peptide Chemical peptide CND10-Detailed Image 5 Shop High-Purity Peptide Globally Best-Selling Good price fast delivery peptide Chemical peptide CND10-Detailed Image 6

    Shop High-Purity Peptide Globally Best-Selling Good price fast delivery peptide Chemical peptide CND10-Detailed Image 7

      Delivery&Shipment

    Shop Most-C Wholesale Peptide with Fast Global Shipping and Custom Packaging Hot sale-Detailed Image 6

    Shop High-Purity Peptide Globally Best-Selling Good price fast delivery peptide Chemical peptide CND10-Detailed Image 9

    Shop High-Purity Peptide Globally Best-Selling Good price fast delivery peptide Chemical peptide CND10-Detailed Image 10

    Shop High-Purity Peptide Globally Best-Selling Good price fast delivery peptide Chemical peptide CND10-Detailed Image 11

    Items Specifications
    Name CND10
    CAS 154947-66-7

    Purity

    Appearance

    Heavy Metals

    Residual TFA

    Available Specification

    99%

    White lyophilized powder

    <10 ppm

    ≤0.5%

    10mg per  vial


    ECHEMI Editorial Reference
    LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.
    Research & Reference Note

    High-Purity Peptide Globally Best-Selling Good price fast delivery peptide Chemical peptide CND10 is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals

    Certificates

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Polypeptide

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Manufactory

    Main Products:

    retatrutide,TB-500,GHK-CU,peptide

    Location:

    1-1, Kailuo Road, Taojia Town, Jiulongpo District, Chongqing

    Payment Terms:

    TT against copy of documents,L/C,TT against B/L draft before shipment,100% TT in advance

    Total Annual Revenue:

    $10 million-$25 million

    Total Employees:

    501-1000

    Year of Establishment:

    2023

    Pharma Grade Peptides is your premium source for high-quality purified research peptides.

    We have served over 20,000 customers on Alibaba and now offer the same quality at our independent store.

    Over the course of many years, we have empowered researchers and scientists to
    explore new avenues of scientific discovery.

  • Inquiry History
    3 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL 37

    1  Aug 6, 2026
    Indonesia

    LL 37

    1  Aug 6, 2026
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.