 Home > Biochemical Engineering > Polypeptide > LL-37 for Sale > High-Purity Peptide Globally Best-Selling Good price fast delivery peptide Chemical peptide CND10

High-Purity Peptide Globally Best-Selling Good price fast delivery peptide Chemical peptide CND10 buy - large image1

High-Purity Peptide Globally Best-Selling Good price fast delivery peptide Chemical peptide CND10 buy - image1

High-Purity Peptide Globally Best-Selling Good price fast delivery peptide Chemical peptide CND10 buy - image2

High-Purity Peptide Globally Best-Selling Good price fast delivery peptide Chemical peptide CND10 buy - image3

High-Purity Peptide Globally Best-Selling Good price fast delivery peptide Chemical peptide CND10 buy - image4

High-Purity Peptide Globally Best-Selling Good price fast delivery peptide Chemical peptide CND10

Name: High-Purity Peptide Globally Best-Selling Good price fast delivery peptide Chemical peptide CND10
Brand: Tong Peptides
SKU: pr2609111894
Price: 145 USD
Availability: InStock

TDS 3 Inquiries

Unit Price:

$145-150/UNIT FOB

Get Latest Price 

CAS No.:

154947-66-7

Grade:

High Purity Grade

Content:

99%

Port:

Shenzhen

Brand:

Tong Peptides

Packaging:

5mg/vial, 10 vials/box

Price valid (until):

2027-03-05

Contact Supplier

 Chat Now

Tong peptides

Company Type:

Manufactory

Location:

China

Payment Terms:

TT against copy of documents,L/C,TT against B/L draft before shipment,100% TT in advance

Qualification:

Main Products:

retatrutide,TB-500,GHK-CU,peptide

 Visit Store

Product Description
Seller Information
Inquiry History

Description

Product Detail

Name:Chloe

Whatsapp:+852 6572 8571

Email Address:chloe@tongpeptides.com

What is CND10 ?

CND10 is catalog designation for CND10, 10 mg per vial. Produced by solid‑phase peptide synthesis, supplied as white lyophilized powder with tested purity ≥98%.

In laboratory studies, CND10 is applied for in‑vitro and pre‑clinical experiments including lipid transport mechanism, mitochondrial energy metabolism, hepatic lipid processing, methylation biochemical pathway and related metabolic biological‑model research. This item is lab‑grade research raw material only for biochemistry and molecular‑cell research projects.

Store unopened lyophilized powder at ‑20℃, keep dry and away from light. Reconstitute with 0.9% BAC bacteriostatic water. After reconstitution, store at 2‑8℃ refrigeration. Gently swirl the vial to dissolve powder, do not shake violently. Avoid repeated freeze‑thaw cycles, aliquot is recommended for dissolved solution.

Why choose us?
1.High quality products with competitive pricing.
2.Free samples available for your evaluation and testing.
3.Fast, reliable delivery via reputable shipping lines.
4.Trial orders are welcome for quality verification after sample approval.
5.Proactive updates and full transparency at every stage of your order.
6.Custom packaging solutions tailored to meet your specific requirements.

Item	Details
Product Name	CND10
Appearance	White Lyophilized Powder
Purity	≥99%
CAS No.	154947-66-7
Specification	10mg per vial
Storage (Unopened)	-20℃, Keep dry and away from light
Storage (After reconstitution)	2-8℃ refrigerated, use within 7-12 days
Solvent for reconstitution	BAC water (Benzyl Alcohol 0.9%)
Shelf life	24 months under proper storage

Shop High-Purity Peptide Globally Best-Selling Good price fast delivery peptide Chemical peptide CND10-Detailed Image 1

Shop High-Purity Peptide Globally Best-Selling Good price fast delivery peptide Chemical peptide CND10-Detailed Image 2

Shop High-Purity Peptide Globally Best-Selling Good price fast delivery peptide Chemical peptide CND10-Detailed Image 3

Application

CND10 is widely used in academic laboratory research, including cell activity research, fibroblast related experiments, oxidative stress mechanism, inflammatory response study, tissue repair mechanism and pre-clinical biological model research.

FAQ

Q1: Can you provide COA for CND10?

A: Yes, official batch COA test report can be provided.

Q2: What solvent is suitable for reconstitution?

A: We recommend 0.9% BAC bacteriostatic water for best solubility and activity retention.

Q3: How long can reconstituted CND10 be stored?

A: 2-8℃ refrigerated storage, valid for 7-10 days after dissolving.

Shop High-Purity Peptide Globally Best-Selling Good price fast delivery peptide Chemical peptide CND10-Detailed Image 4

Shop High-Purity Peptide Globally Best-Selling Good price fast delivery peptide Chemical peptide CND10-Detailed Image 5

Shop High-Purity Peptide Globally Best-Selling Good price fast delivery peptide Chemical peptide CND10-Detailed Image 7

Delivery&Shipment

Shop Most-C Wholesale Peptide with Fast Global Shipping and Custom Packaging Hot sale-Detailed Image 6

Shop High-Purity Peptide Globally Best-Selling Good price fast delivery peptide Chemical peptide CND10-Detailed Image 9

Shop High-Purity Peptide Globally Best-Selling Good price fast delivery peptide Chemical peptide CND10-Detailed Image 10

Shop High-Purity Peptide Globally Best-Selling Good price fast delivery peptide Chemical peptide CND10-Detailed Image 11

Items

Specifications

Name

CND10

CAS

154947-66-7

Purity

Appearance

Heavy Metals

Residual TFA

Available Specification

99%

White lyophilized powder

＜10 ppm

≤0.5%

10mg per vial

ECHEMI Editorial Reference

LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.

Research & Reference Note

High-Purity Peptide Globally Best-Selling Good price fast delivery peptide Chemical peptide CND10 is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

Authoritative sources

Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals

Certificates

Basic Info

Product Name:

LL-37

Other Name:

Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

CAS No.:

154947-66-7

Molecular Formula:

C205H340N60O53

InChIKeys:

POIUWJQBRNEFGX-XAMSXPGMSA-N

Molecular Weight:

EC Number:

211-519-9

Color/Form:

White to off-white

Categories:

Polypeptide

Characteristics

Water Solubility:

Soluble to 1 mg/ml in water

Seller Information

Business Type:
Manufactory

Main Products:
retatrutide,TB-500,GHK-CU,peptide

Location:
1-1, Kailuo Road, Taojia Town, Jiulongpo District, Chongqing

Payment Terms:
TT against copy of documents,L/C,TT against B/L draft before shipment,100% TT in advance

Total Annual Revenue:
$10 million-$25 million

Total Employees:
501-1000

Year of Establishment:
2023

Pharma Grade Peptides is your premium source for high-quality purified research peptides.

We have served over 20,000 customers on Alibaba and now offer the same quality at our independent store.

Over the course of many years, we have empowered researchers and scientists to
explore new avenues of scientific discovery.

Inquiry History

3 Inquiries

Country	Product	Purchase Quantity	Date Posted
Indonesia	LL 37	1	Aug 6, 2026
Indonesia	LL 37	1	Aug 6, 2026
Indonesia	LL-37	5 MG	Jun 23, 2026

Post an enquiry for this product

More Choices Find All Products for Sale 

Product Name	Grade / Content	Price	Supplier Name	Details
Factory Supply high quality LL-37 (hCAP18) Cationic Peptide, High Purity Lyophilized Powder for Immunology & Antimicrobial Research	Pharmaceutical Grade/99	$70-80/BOU FOB	Yiwu Nianwu	Inquiry
high-purity 99% Chinese peptide SuperHumanBlend SUR10 TA5 TB Thymosin Acetate Tesamorel Thymosin Alpha TR10 TR15	Cosmetics Grade/99	$1/G FOB	Chengtai Co., Ltd.	Inquiry
LL37 \| hot sale \| Cosmetic Peptides \| 99% Purity \| 5mg 10mg Vials \| Lyophilized Powder	Pharmaceutical Grade/99	$33/G FOB	Guangzhou Changkai Trading Co., Ltd.	Inquiry
wholesales peptides Cas 154947-66-7 LL37 5mg with high quatity with 5mg	Pharmaceutical Grade/99	$95/UNIT FOB	Beijing Novio Biotechnology Co., Ltd.	Inquiry
LL37 375 high purity and High Quality 99% Purity with factory price	Pharmaceutical Grade/99	$22-23/UNIT FOB	Jielu Trading	Inquiry

High-Purity Peptide Globally Best-Selling Good price fast delivery peptide Chemical peptide CND10

Product Description

Seller Information

Inquiry History

More Choices Find All Products for Sale 

Related Searches

More from this Seller