Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > wholesales peptides Cas 154947-66-7 LL37 5mg with high quatity with 5mg
wholesales peptides Cas 154947-66-7 LL37 5mg with high quatity with 5mg buy - large image1
wholesales peptides Cas 154947-66-7 LL37 5mg with high quatity with 5mg buy - image1
wholesales peptides Cas 154947-66-7 LL37 5mg with high quatity with 5mg buy - image2
wholesales peptides Cas 154947-66-7 LL37 5mg with high quatity with 5mg buy - image3
wholesales peptides Cas 154947-66-7 LL37 5mg with high quatity with 5mg buy - image4
wholesales peptides Cas 154947-66-7 LL37 5mg with high quatity with 5mg buy - image5
wholesales peptides Cas 154947-66-7 LL37 5mg with high quatity with 5mg buy - image6

wholesales peptides Cas 154947-66-7 LL37 5mg with high quatity with 5mg

TDS 3 Inquiries

Unit Price:

$95/UNIT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

HongKong

Brand:

Novio

Packaging:

5mg*10vials

Price valid (until):

2026-10-09

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Peptides,Cosmetic Raw Materials,Pharmaceutical Intermediates

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


    WhatsApp: +852 9335 4794

    Email: 15030963274@163.com

    L L-37

    Bioactive 
    LL37 (Human cathelicidin, Ropocamptide) is an antimicrobial peptide related to cathelicidin, with potent chemotactic and immunomodulatory properties.

    Ll-37, Human is an amphiphilic cathepsin derived antimicrobial peptide with 37 residues and has a wide range of antibacterial activities. Ll-37, Human helps protect the cornea from infection and regulate wound healing.

    • The importance of peptides:
    • Many active substances in the human body are in the form of peptides. Peptides are involved in various fields of human hormones, nerves, cell growth and reproduction, and their importance is to regulate the physiological functions of various systems and cells in the body, activate the relevant enzyme systems in the body, promote the permeability of intermediate metabolic membranes, or control DNA transcription or affect specific protein synthesis, and ultimately produce specific physiological effects. Peptides are important substances involved in various cell functions in human body. Peptides can be synthesized into cells and regulate their functional activities. Peptides act as neurotransmitters in the body, transmitting information. Peptides can be used as transportation tools in the human body to transport various nutrients and various vitamins, biotin, calcium and trace elements beneficial to the human body to the cells, organs and tissues of the human body. Peptide is an important physiological regulator of the human body, which can comprehensively regulate the physiological function of the human body, enhance and exert the physiological activity of the human body, and it has important biological functions.

    • Elamipretide acetate is a small molecule polypeptide composed of four amino acids. In the body, elamipretide targets the inner membrane of mitochondria and can prevent oxidative damage to neurons and other cell types; prevent mitochondrial depolarization, reduce islet cell apoptosis, increase islet cell production, and improve post-transplantation function.

      Application:

      1. LL37 has been used as an antimicrobial agent to improve wound healing.

      2. LL37 has been used as a vaccine adjuvant to enhance the immune response of vaccines.

      3. LL37 has been used as a therapeutic agent for the treatment of inflammatory diseases such as asthma and cystic fibrosis.

      4. LL37 has been used as an immunomodulator to modulate the immune response and enhance the production of pro-inflammatorycytokines and chemokines.

      5. LL37 has been studied as a potential target for cancer therapy, due to its ability to induce apoptosis and inhibit cancer cell growth.

      6. LL37 has been studied as a potential target for antiviral therapy due to its ability to inhibit the replication of viruses.


      Ll-37, Human is an amphiphilic cathepsin derived antimicrobial peptide with 37 residues and has a wide range of antibacterial activities. Ll-37, Human helps protect the cornea from infection and regulate wound healing.


      LL37 (Human cathelicidin, Ropocamptide) is an antimicrobial peptide related to cathelicidin, with potent chemotactic and immunomodulatory properties.

      Ll-37, Human is an amphiphilic cathepsin derived antimicrobial peptide with 37 residues and has a wide range of antibacterial activities. Ll-37, Human helps protect the cornea from infection and regulate wound healing.

      The importance of peptides:
      Many active substances in the human body are in the form of peptides. Peptides are involved in various fields of human hormones, nerves, cell growth and reproduction, and their importance is to regulate the physiological functions of various systems and cells in the body, activate the relevant enzyme systems in the body, promote the permeability of intermediate metabolic membranes, or control DNA transcription or affect specific protein synthesis, and ultimately produce specific physiological effects. Peptides are important substances involved in various cell functions in human body. Peptides can be synthesized into cells and regulate their functional activities. Peptides act as neurotransmitters in the body, transmitting information. Peptides can be used as transportation tools in the human body to transport various nutrients and various vitamins, biotin, calcium and trace elements beneficial to the human body to the cells, organs and tissues of the human body. Peptide is an important physiological regulator of the human body, which can comprehensively regulate the physiological function of the human body, enhance and exert the physiological activity of the human body, and it has important biological functions.

    Items Specifications
    Product Name LL37
    Purity 99%
    Specification 10 vials per box
    Appearance White Powder
    Shop wholesales peptides Cas 154947-66-7 LL37 5mg with high quatity with 5mg-Detailed Image 1
    Shop wholesales peptides Cas 154947-66-7 LL37 5mg with high quatity with 5mg-Detailed Image 2
    Shop wholesales peptides Cas 154947-66-7 LL37 5mg with high quatity with 5mg-Detailed Image 3
    Shop wholesales peptides Cas 154947-66-7 LL37 5mg with high quatity with 5mg-Detailed Image 4
    Shop wholesales peptides Cas 154947-66-7 LL37 5mg with high quatity with 5mg-Detailed Image 5
    Shop wholesales peptides Cas 154947-66-7 LL37 5mg with high quatity with 5mg-Detailed Image 6
    Shop wholesales peptides Cas 154947-66-7 LL37 5mg with high quatity with 5mg-Detailed Image 7
    Shop wholesales peptides Cas 154947-66-7 LL37 5mg with high quatity with 5mg-Detailed Image 8
    Shop wholesales peptides Cas 154947-66-7 LL37 5mg with high quatity with 5mg-Detailed Image 9
    Shop wholesales peptides Cas 154947-66-7 LL37 5mg with high quatity with 5mg-Detailed Image 10

    FAQ

    1. How do you ensure product quality?

    We have a strict quality management system, all batches must be tested and meet our standards before entering the warehouse. The purity of all our products is above 99.00%, which has been verified by many American and European customers.


    2. How to place an order with you?

    After confirming the dosage/strength and quantity of the required product with the customer, our business personnel will make a Proforma Invoice or Sales Contract. After the customer confirms and pays for the order, we will arrange shipment for the customer as soon as possible.


    3. What payment methods are there?

    There are Bank Transfer, Wise, Revolut, Tether USD(USDT) and Bitcoin; we can also accept payments in CNY, for example, through Alipay or WeChat.


    4. What shipping methods can we choose?

    Usually express delivery is more suitable, including DHL, FedEx, UPS, etc. For Russia, we also have a dedicated express channel (double customs clearance). We will be responsible for customs clearance in the destination country, and customers are not required to cooperate with customs clearance and pay any tariffs.


    ECHEMI Editorial Reference
    LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.
    Research & Reference Note

    wholesales peptides Cas 154947-66-7 LL37 5mg with high quatity with 5mg is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals

    Certificates
    • wholesales peptides Cas 154947-66-7 LL37 5mg with high quatity with 5mg Certificates 1 TDS

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Peptides,Cosmetic Raw Materials,Pharmaceutical Intermediates

    Location:

    Room 1359, Room 103, Building Jia 19, Jixiang Garden, Tongzhou District, Beijing

    Year of Establishment:

    2026

  • Inquiry History
    3 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.