Product
Supplier
Encyclopedia
Inquiry
Home > Biochemical Engineering > Polypeptide > LL-37 for Sale > Factory Supply high quality LL-37 (hCAP18) Cationic Peptide, High Purity Lyophilized Powder for Immunology & Antimicrobial Research
Factory Supply high quality LL-37 (hCAP18) Cationic Peptide, High Purity Lyophilized Powder for Immunology & Antimicrobial Research buy - large image1
Factory Supply high quality LL-37 (hCAP18) Cationic Peptide, High Purity Lyophilized Powder for Immunology & Antimicrobial Research buy - image1
Factory Supply high quality LL-37 (hCAP18) Cationic Peptide, High Purity Lyophilized Powder for Immunology & Antimicrobial Research buy - image2
Factory Supply high quality LL-37 (hCAP18) Cationic Peptide, High Purity Lyophilized Powder for Immunology & Antimicrobial Research buy - image3
Factory Supply high quality LL-37 (hCAP18) Cationic Peptide, High Purity Lyophilized Powder for Immunology & Antimicrobial Research buy - image4
Factory Supply high quality LL-37 (hCAP18) Cationic Peptide, High Purity Lyophilized Powder for Immunology & Antimicrobial Research buy - image5
Factory Supply high quality LL-37 (hCAP18) Cationic Peptide, High Purity Lyophilized Powder for Immunology & Antimicrobial Research buy - image6

Factory Supply high quality LL-37 (hCAP18) Cationic Peptide, High Purity Lyophilized Powder for Immunology & Antimicrobial Research

3 Inquiries

Unit Price:

$70-80/BOU FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

guangzhou

Brand:

kunyao

Packaging:

5mg /vial,10vials/box

Price valid (until):

2027-02-01

Company Type:
Trader
Location:
China
Qualification:
Main Products:

PEPTIDES

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


    Name: Kitty

    WhatsApp:+86 135 2654 2669



    Are there discounts available?
    Answer: Yes, the larger the purchase quantity, the greater the discount.

    All employees of the company are committed to the continuous pursuit of superior quality and an impeccable brand image. Upholding a spirit of integrity, diligence, truth-seeking, and progress—and guided by the business philosophy that "quality is life and service is the soul"—they provide first-class products and services to meet market demands and stand ready to face market challenges at all times.


    Product  Description:


    LL-37 is the C-terminal fragment derived from human hCAP18, a cationic synthetic peptide with 37 amino acid residues, CAS 154947-66-7. The product is white lyophilized powder, HPLC purity ≥98%. It is commonly used in in vitro and in vivo academic research, covering broad-spectrum antimicrobial properties, immunomodulation and biofilm related laboratory studies. Strict quality control is implemented during peptide synthesis. Each batch is accompanied by full supporting documents: COA, HPLC and mass spectrometry. Available packages: 5mg,10mg,50mg,100mg per glass vial, custom packaging acceptable.



    Items Specifications
    Product Name LL-37 / Human Cathelicidin
    CAS No. 154947-66-7
    Appearance White lyophilized powder

    Advantages

    1. ✅ High purity ≥98% HPLC, stable batch-to-batch consistency

    2. ✅ Complete test documents: COA, HPLC, MS available for each batch

    3. ✅ Professional peptide synthesis workshop with strict QC

    4. ✅ Multiple vial sizes:5mg,10mg,50mg,100mg; custom packing supported

    5. ✅ Good solubility, stable lyophilized powder under proper storage

    6. ✅ Sufficient stock and fast shipment for research orders

    7. ✅ Professional technical support for laboratory research projects





    Shop Factory Supply high quality LL-37 (hCAP18) Cationic Peptide, High Purity Lyophilized Powder for Immunology & Antimicrobial Research-Detailed Image 1

    Shop Bulk GHK Cu Copper Tripeptide 1 Blue Copper Peptide Powder Anti Aging Cosmetic Raw Material CAS 49557 75 7-Detailed Image 1
    Shop Bulk GHK Cu Copper Tripeptide 1 Blue Copper Peptide Powder Anti Aging Cosmetic Raw Material CAS 49557 75 7-Detailed Image 2
    Shop Bulk GHK Cu Copper Tripeptide 1 Blue Copper Peptide Powder Anti Aging Cosmetic Raw Material CAS 49557 75 7-Detailed Image 3
    Shop Bulk GHK Cu Copper Tripeptide 1 Blue Copper Peptide Powder Anti Aging Cosmetic Raw Material CAS 49557 75 7-Detailed Image 4



    Shop Bulk GHK Cu Copper Tripeptide 1 Blue Copper Peptide Powder Anti Aging Cosmetic Raw Material CAS 49557 75 7-Detailed Image 5 Shop Bulk GHK Cu Copper Tripeptide 1 Blue Copper Peptide Powder Anti Aging Cosmetic Raw Material CAS 49557 75 7-Detailed Image 6 Shop Bulk GHK Cu Copper Tripeptide 1 Blue Copper Peptide Powder Anti Aging Cosmetic Raw Material CAS 49557 75 7-Detailed Image 7
    Shop Bulk GHK Cu Copper Tripeptide 1 Blue Copper Peptide Powder Anti Aging Cosmetic Raw Material CAS 49557 75 7-Detailed Image 8




    Why choose us?

    Our Advantages:
    1.High quality with competitive price.
    2.All purity>99%.
    3. We are manufacturer and can provide high quality products with factory price.

    Fast and safe delivery:
    1. Parcel can be sent out in 48 hours after payment tracking number available.
    2. Secure and discreet shipment verious transportation methods for your choice.
    3. Customs pass rate >99%.

    Shop Bulk GHK Cu Copper Tripeptide 1 Blue Copper Peptide Powder Anti Aging Cosmetic Raw Material CAS 49557 75 7-Detailed Image 9
    Shop Bulk GHK Cu Copper Tripeptide 1 Blue Copper Peptide Powder Anti Aging Cosmetic Raw Material CAS 49557 75 7-Detailed Image 10
    Shop Bulk GHK Cu Copper Tripeptide 1 Blue Copper Peptide Powder Anti Aging Cosmetic Raw Material CAS 49557 75 7-Detailed Image 11
    Shop Bulk GHK Cu Copper Tripeptide 1 Blue Copper Peptide Powder Anti Aging Cosmetic Raw Material CAS 49557 75 7-Detailed Image 12
    ECHEMI Editorial Reference
    LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.
    Research & Reference Note

    Factory Supply high quality LL-37 (hCAP18) Cationic Peptide, High Purity Lyophilized Powder for Immunology & Antimicrobial Research is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Polypeptide

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    PEPTIDES

    Location:

    Room 305, 3rd Floor, Unit 2, Building 48, Datangxia Zone 2, Choucheng Subdistrict, Yiwu, Jinhua, Zhejiang Province, China

    Year of Establishment:

    2026

  • Inquiry History
    3 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL 37

    1  Aug 6, 2026
    Indonesia

    LL 37

    1  Aug 6, 2026
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.