Product
Supplier
Encyclopedia
Inquiry
Home > Active Pharmaceutical Ingredients > Other Chemical Drugs > LL-37 for Sale > LL37 High quality, high purity, low price CAS 154947-66-7 with factory price
LL37 High quality, high purity, low price CAS 154947-66-7 with factory price buy - large image1
LL37 High quality, high purity, low price CAS 154947-66-7 with factory price buy - image1
LL37 High quality, high purity, low price CAS 154947-66-7 with factory price buy - image2
LL37 High quality, high purity, low price CAS 154947-66-7 with factory price buy - image3
LL37 High quality, high purity, low price CAS 154947-66-7 with factory price buy - image4
LL37 High quality, high purity, low price CAS 154947-66-7 with factory price buy - image5
LL37 High quality, high purity, low price CAS 154947-66-7 with factory price buy - image6

LL37 High quality, high purity, low price CAS 154947-66-7 with factory price

3 Inquiries

Unit Price:

$101/UNIT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

shenzhen

Brand:

ZM

Packaging:

5mg/vial; 10vials/box

Sample Available:

Yes

Price valid (until):

2029-11-22

Company Type:
Trader
Location:
China
Payment Terms:
TT against copy of documents,100% TT in advance
Average Lead Time:
1 days
Qualification:
Main Products:

GLP-1,Retatrutide,Selank,Tirzepatide

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


    WhatsApp/WeChat :+86 177 3303 8959

    Email:Demi@hzzmtrade.com

    Sales Manager:Demi

    Shop LL37 High quality, high purity, low price CAS 154947-66-7 with factory price-Detailed Image 1

    Shop Best Price Weight Loss Peptides Tirzepatide 10mg In Vials-Detailed Image 2

    • LL37 5mg 

      Purity: >99% (or refer to the Certificate of Analysis) Storage Condition: Dry, dark and at 0 - 4 C for short term (days to weeks) or -20 C for long term (months to years).

      Shelf Life: >2 years if stored properly Stock Solution Storage: 0 - 4 C for short term (days to weeks), or -20 C for long term (months). 

      It exhibits potent antimicrobial activity against Gram‑positive and Gram‑negative bacteria, fungi, and enveloped viruses. Beyond direct microbial killing, LL‑37 regulates inflammation, promotes wound healing, modulates immune cell recruitment, and supports tissue repair. It is widely studied in immunology, dermatology, infection research, and mucosal defense.

      Production:
      Manufactured via solid-phase peptide synthesis (SPPS), followed by purification and lyophilization to obtain the final product.

      NOTE: This product was prepared by chemical synthesis. Used only for research. Not for human use.

    Items Specifications
    CAS number
    154947-66-7
    Purity
    99%
    Appearance
    White powder
    Storage
    -20


      Product Production  



    Shop Weight Loss Top Quality Peptides Lyophilized Powder Tirzepatide-Detailed Image 3
    Shop Weight Loss Top Quality Peptides Lyophilized Powder Tirzepatide-Detailed Image 4
    Shop Weight Loss Top Quality Peptides Lyophilized Powder Tirzepatide-Detailed Image 5
    Shop Weight Loss Top Quality Peptides Lyophilized Powder Tirzepatide-Detailed Image 6


      Transportation & Payment  


    Shop Weight Loss Top Quality Peptides Lyophilized Powder Tirzepatide-Detailed Image 8
    Shop Weight Loss Top Quality Peptides Lyophilized Powder Tirzepatide-Detailed Image 9

    Packing
    Product Specifications
    5mg/vial,10vials/box
    10mg/vial,10vials/box
    15mg/vial,10vials/box
    20mg/vial,10vials/box
    30mg/vial,10vials/box
    40mg/vial,10vials/box
    50mg/vial,10vials/box
    60mg/vial,10vials/box


      About Us  


    Shop Weight Loss Top Quality Peptides Lyophilized Powder Tirzepatide-Detailed Image 10
    Shop Weight Loss Top Quality Peptides Lyophilized Powder Tirzepatide-Detailed Image 11
    Shop Weight Loss Top Quality Peptides Lyophilized Powder Tirzepatide-Detailed Image 12
    Shop LL37 High quality, high purity, low price CAS 154947-66-7 with factory price-Detailed Image 12

    Our company is located in Hangzhou and is a company specializing in the research, production and development of peptide products. Founded in recent years, the company is committed to applying advanced biotechnology to the health industry to meet the market demand for high-quality and high-efficiency peptide products.

    We have an experienced professional team that is dedicated to providing innovative solutions and excellent customer service. We work closely with our clients, relying on advanced production facilities and strict quality control systems, to ensure that our products meet the highest safety and purity standards.

    Over the years, we have continuously supplied new products to markets such as Europe, America, Australia, Japan and Southeast Asia. We have always adhered to the corporate principle of "quality and reputation first", and through years of continuous development, we have gained a good reputation in the fitness industry.

    We provide customers with first-class products, competitive prices and top-notch services to meet the individual needs of each customer.
    We have collaborated with numerous leading logistics companies worldwide, and with a wide global transportation network, we ensure that our safe and efficient logistics services can meet your urgent needs. We look forward to establishing a long-term business partnership with you on the basis of equality and mutual benefit.


      FAQ  


    Q1. How do you ensure product quality?

    A1. We have a strict quality management system in place. All batches must pass tests and meet our
    standards before being released into the warehouse.

    Q2: Why should you buy from us instead of other suppliers?

    A2: Because we are a factory, we can provide lower prices and guaranteed quality. We have extensiveexperience in domestic and foreign trade and provide services in an honest, timely and efficient manner.

    Q3: How to place an order for each product?

    A3: Please send us an inquiry and let us know your requirements; we will send you a complete quotation
    including freight, confirm the order and send payment/deposit, we willarrange production or delivery of
    the goods after receiving the bank receipt.

    Q4: Do you have stock?

    A4: We understand most customers prefer stock, so we'll try to keep stock for most products. However,
    for some rare products, we won't keep stock and it needs time to synthesize.

    Q5: What's your MOQ?

    A5: For this product, 10vials/box (5mg/10mg/15mg/20mg/30mg/vial), minimum order is 1 boxes.

    Q6: Is there a discount?

    A6: Different quantity has different discount, for larger quantity, we alway support with better price.

    .Q7:How to make an order?

    A7:Please send us a message and inform us of your required products and quantity. Then we will calculate the quotation for you promptly.

    Q8:Can we do printing or labeling on the bottles?

    A8:Yes, you can. We offer various printing methods, such as screen printing, hot stamping and label printing.

    Q9:What is the normal lead time?

    A9:For in-stock products, we will ship them within 24-48 hours after receiving your payment. For small-batch customized color bottles, the delivery time is 3-15 days.

    ECHEMI Editorial Reference
    LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Other Chemical Drugs

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    GLP-1,Retatrutide,Selank,Tirzepatide

    Location:

    #704-A008, Building 11, Block 16, Liangzhu Street, Yuhang District, Hangzhou City, Zhejiang Province

    Payment Terms:

    TT against copy of documents,100% TT in advance

    Average lead Time:

    1 days

    Total Annual Revenue:

    Less than $1 million

    Total Employees:

    51-100

    Year of Establishment:

    2025

    Our company located in Hangzhou City, is a high-tech enterprise focusing on the research, development and production of peptide products. The company was established in recent years and is committed to applying advanced biotechnology to the health industry to meet the market's demand for high-quality, high-efficiency peptide products.

    Our team of experienced professionals is committed to delivering innovative solutions and exceptional customer service. We work closely with our clients to understand their unique needs and develop customized products to meet their specific requirements. With a state-of-the-art manufacturing facility and strict quality control measures, we ensure that our products meet the highest standards of safety and purity.

  • Inquiry History
    3 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.