Product
Supplier
Encyclopedia
Inquiry
LL37 99% freeze buy - large image1
LL37 99% freeze buy - image1
LL37 99% freeze buy - image2
LL37 99% freeze buy - image3
LL37 99% freeze buy - image4
LL37 99% freeze buy - image5
LL37 99% freeze buy - image6

LL37 99% freeze

3 Inquiries

Unit Price:

$100/G FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Industrial Grade

Content:

99%

Port:

shenzhen

Brand:

peptide

Packaging:

1500mg*10vials

Price valid (until):

2026-10-22

Company Type:
Trader
Location:
China
Payment Terms:
TT against copy of documents,D/A,100% TT in advance
Average Lead Time:
15 days
Qualification:
Main Products:

Retatrutide,Tirzepatide,Semaglutide,GHK-CU

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


    This research-grade custom synthetic peptide (GTT1500) is produced in our GMP-certified manufacturing facility, adhering to rigorous quality control standards throughout the production process. It is designated exclusively for laboratory research use only (RUO) and is not intended for human or veterinary applications.
    Each vial contains high-purity GTT1500 lyophilized powder, with a purity of ≥99% as confirmed by HPLC analysis. Comprehensive analytical documentation, including COA (Certificate of Analysis), HPLC chromatograms, and mass spectrometry (MS) data, is available upon request to support your research validation and quality assurance protocols.
    Our production workflow ensures exceptional batch-to-batch consistency, minimizing variability and supporting reliable experimental outcomes. We offer flexible packaging configurations (e.g., 5mg/vial, 10mg/vial, custom bulk quantities) to accommodate diverse research project scales and timelines. Stable, long-term supply chains are maintained to meet ongoing research demands.
    We welcome global research institutions, pharmaceutical R&D teams, and laboratory partners to inquire about product specifications, request analytical samples for preliminary evaluation, and explore opportunities for long-term collaborative supply partnerships. Our dedicated technical support team is available to assist with product handling, storage recommendations, and research-related inquiries, complemented by efficient global logistics solutions to ensure timely delivery





    Transportation and packaging:

    Product Packaging: Each box contains 10 pieces (the size, label and packaging box can be customized according to customer requirements).
    Transport Conditions: This product is transported as a non-hazardous chemical at normal temperature. During ordinary transportation and customs clearance, this product can be stably stored for several weeks. Storage Conditions: For short-term storage (from a few days to several weeks), it should be placed in a dry and cool place at 0-4℃. For long-term storage (from several months to several years), it should be stored at -20℃. After re-dissolution, please store it refrigerated at 2-8℃ (35.6-46.4℉) and use it within 2-4 weeks.

    We mainly adopt dedicated logistics and FedEx transportation methods, which can ensure the timeliness of shipment, rapid delivery, stable logistics tracking, and safe and punctual delivery.Quick delivery

    Regarding after-sales service
    A: After you purchase the products from our laboratory, we will have a professional technical team and an after-sales team to serve you and solve all the problems you may encounter in the future.

    Shop 5AM  Bodyybuilding 5-Amino-1mq CAS 42464-96-0 Fat Burning Weight Loss 5 Amino-Detailed Image 10

    FAQ

    Q: How to order this product?

    A:You can send us your Purchase order(if your company has), or just send a simple confirmation by email or message, we will send you order confirmation, then you can make your order accordingly.

    Q: How long can I receive my ordered goods?

    A: We ship by special line shipping door to door; you can receive it in about 3-10days.

    Q: What's your MOQ?

    A:For the regular products, our MOQ is 1box; For other customized products, our MOQ starts from 10boxes to 50boxes.

    Q: Is there a discount?

    A: Yes, for larger quantity order, we always support with better price.

    Q: How to store it?

    A: If it hasn't been opened, just put it in cool dry place, if it is opened, you may put it in cold storage for 2-5 degree condition.

    Q:We have clients throughout the world

    A:1)Professional service and rich experience make customers feel at ease, adequate stock and fast delivery meet their different desire.

    2)Market feedback and goods feedback will be appreciated, meeting customers' requirement is our principal responsibility.

    3)High quality, competitive price, fast delivery, first-class service gain the trust and praise from all the customers.

    Q:How to proceed your order:

    Step 1:Add my WhatsApp number,Please let me know the items you are favorable, quantities, and the destination country.

    Step 2:You confirm all detail, and offer purchasing order.

    Step 3:We send the detail price of our product and offer the suitable shipping method for reference.

    Step 4:You confirm the order and payment 100% in advance and send us the detailed contacting information, including contacting person/company,address,mobile number,ZIP code and your special requirements.

    Step5:We arrange the shipment according to your requirements, and tracking code will be offered once it is released, then you can track your parcel at any moment.

    Step 6:We offer after-sales services after service after you receive your parcel

    Items Specifications






    ECHEMI Editorial Reference
    LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Skin Protecting

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Retatrutide,Tirzepatide,Semaglutide,GHK-CU

    Location:

    Room 1209, 12th Floor, Unit 1, Building 1, Block A, Shenglong Plaza, No.80 Weiyang Road, Weiyang District, Xi'an City, Shaanxi Province, P.R.China

    Payment Terms:

    TT against copy of documents,D/A,100% TT in advance

    Average lead Time:

    15 days

    Total Annual Revenue:

    $1 million-$2.5 million

    Total Employees:

    11-50

    Year of Establishment:

    2025

    Xi'an Haoming Technology Co., Ltd. Founded in 2020, we are a professional supplier of high‑quality functional peptides. Our main product range includes weight‑loss peptides, anti‑wrinkle peptides, tanning peptides and other active peptide ingredients, widely used in cosmetics, skincare and health‑care industries. Strict quality‑control standards are applied throughout raw‑material screening, production and shipment to deliver consistent and reliable product quality.

    Putting customer value first, we supply premium‑grade products with competitive pricing, flexible MOQs and on‑time delivery. Our goods are well‑sold across Europe, the UK, the USA, Canada, Australia and other regions, earning wide recognition and trust from global buyers.

    We maintain stable independent international logistics channels covering the USA, Canada, UK, Germany, Spain, Poland, the Netherlands, Russia, Kazakhstan and more. One‑stop door‑to‑door delivery with full customs‑clearance service is available to free customers from cross‑border logistics troubles.

    Upholding the business philosophy of “Survive by Quality, Develop by Reputation”, Xi'an Haoming Technology Co., Ltd. keeps tight control over raw‑material procurement and production procedures. Free samples are offered prior to formal orders. All items are manufactured efficiently under high‑safety standards. Backed by a complete after‑sales system, we deliver prompt replies and professional solutions for satisfying cooperation.

    With consistent integrity, professional technical support and efficient service, we keep providing overseas partners with stable quality, competitive rates and reliable after‑sales support. Xi'an Haoming Technology Co., Ltd. aims to be your trusted long‑term supplier for peptide raw materials.

  • Inquiry History
    3 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL 37

    1  Aug 6, 2026
    Indonesia

    LL 37

    1  Aug 6, 2026
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product

More from this Seller

pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.