Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > LL37 Peptide with High quality wholesales peptides 154947-66-7 with high quatity
LL37 Peptide with High quality wholesales peptides 154947-66-7 with high quatity buy - large image1
LL37 Peptide with High quality wholesales peptides 154947-66-7 with high quatity buy - image1
LL37 Peptide with High quality wholesales peptides 154947-66-7 with high quatity buy - image2
LL37 Peptide with High quality wholesales peptides 154947-66-7 with high quatity buy - image3
LL37 Peptide with High quality wholesales peptides 154947-66-7 with high quatity buy - image4
LL37 Peptide with High quality wholesales peptides 154947-66-7 with high quatity buy - image5
LL37 Peptide with High quality wholesales peptides 154947-66-7 with high quatity buy - image6

LL37 Peptide with High quality wholesales peptides 154947-66-7 with high quatity

TDS 1 Inquiries

Unit Price:

$12-13/BOU FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

China

Brand:

Zhongshuan

Packaging:

10mg*10vials

Price valid (until):

2026-07-22

Company Type:
Trader
Location:
China
Qualification:
Main Products:

peptide

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


    Sales Manager: Judy
    Whatsapp: +86 15227650217
    Email: 17334330163@163.com


    LL-37 Peptide Full English Introduction

    Basic Information

    • CAS No.: 154947-66-7
    • Full name: LL-37 (human cathelicidin antimicrobial peptide)
    • Source: Cleaved from precursor protein hCAP18, the only cathelicidin peptide naturally produced in human body
    • Composition: 37 amino acids, named after two initial leucine residues (LL) + total 37 amino acids
    • Molecular weight: ~4493 Da
    LL-37 is the only human cathelicidin peptide. It targets bacterial cell membranes to eliminate pathogens directly, while regulating skin immune response and stimulating skin cell regeneration.
    1. Disrupt membrane structure of gram-positive bacteria, gram-negative bacteria and fungi to achieve broad-spectrum antibacterial effect 
    2. Suppress overactive inflammatory factors to relieve redness, swelling and irritation
    3. Activate keratinocyte and fibroblast proliferation, accelerate wound tissue repair
    4. Scavenge free radicals to reduce oxidative skin aging
    Items Specifications

    CAS RN

    154947-66-7

    Appearance

    White Powder

    Purity

    99%

    Storage condition

    -20℃


    Core Biological Functions 

    1. Broad-spectrum Antimicrobial Effect

    As cationic amphipathic peptide, it binds negatively charged microbial membranes and breaks membrane structure to kill pathogens directly:
    • Gram-positive & Gram-negative bacteria
    • Fungi, enveloped viruses and parasites
    • Penetrate & destroy bacterial biofilms, hard for bacteria to generate drug resistance compared with common antibiotics

    2. Neutralize Endotoxin & Regulate Inflammation

    It binds LPS (bacterial endotoxin) to block TLR2/TLR4 inflammatory signaling, suppress overproduction of inflammatory factors to relieve sepsis and excessive inflammatory response.

    3. Immune Modulation

    • Chemoattract neutrophils, monocytes and T cells to infection sites to boost innate immunity
    • Balance immune activation, mediate communication between innate and adaptive immune system

    4. Promote Wound Healing & Tissue Repair

    • Stimulate migration and proliferation of keratinocytes & fibroblasts to accelerate wound closure
    • Induce angiogenesis (new blood vessel growth) to supply nutrients for damaged skin/mucosa repair
    • Deficiency of LL-37 leads to hard-to-heal chronic ulcers

    5. Additional Research Directions

    • Skin barrier protection, relieve skin inflammatory lesions
    • Anti-tumor research (induce apoptosis of certain tumor cells)
    • Mucosa defense for respiratory, gastrointestinal and urinary tracts
     

      OUR FACTORY  

     


    We are an innovative enterprise specializing in the research, development, sales, and health services of small molecule bioactive peptides. Leveraging local resources and cutting-edge biotechnology, we are deeply committed to the health industry, dedicated to bringing highly active, easily absorbed, and high-quality peptide products to every household, contributing to the health of the entire population.


    We adhere to the philosophy of "Technology Empowering Health, Quality Shaping the Future," rigorously controlling every step from raw material selection to production processes to ensure that every peptide product possesses the core advantages of high purity, high activity, and high safety. Our products cover multiple categories, including weight loss and fat reduction peptides, beauty and skincare peptides, and muscle-building and body-shaping peptides, catering to diverse health needs such as weight loss and body shaping, daily anti-aging, physical recovery, and immune regulation, providing scientific and efficient nutritional solutions for different groups.


    With the mission of "Making peptide supplementation easy for everyone and enjoying a healthy life," we uphold the principles of integrity and customer first, continuously refining our products and services. We aspire to become a trustworthy peptide product brand in the health industry, working hand in hand with our partners for mutual benefit.


    Shop LL37 Peptide with High quality wholesales peptides 154947-66-7 with high quatity-Detailed Image 1
    Shop LL37 Peptide with High quality wholesales peptides 154947-66-7 with high quatity-Detailed Image 2
    Shop LL37 Peptide with High quality wholesales peptides 154947-66-7 with high quatity-Detailed Image 3
    Shop LL37 Peptide with High quality wholesales peptides 154947-66-7 with high quatity-Detailed Image 4
    Shop LL37 Peptide with High quality wholesales peptides 154947-66-7 with high quatity-Detailed Image 5
    Shop LL37 Peptide with High quality wholesales peptides 154947-66-7 with high quatity-Detailed Image 6
    Shop LL37 Peptide with High quality wholesales peptides 154947-66-7 with high quatity-Detailed Image 7
    Shop LL37 Peptide with High quality wholesales peptides 154947-66-7 with high quatity-Detailed Image 8
    Shop LL37 Peptide with High quality wholesales peptides 154947-66-7 with high quatity-Detailed Image 9
    Shop LL37 Peptide with High quality wholesales peptides 154947-66-7 with high quatity-Detailed Image 10


     
    Items Specifications
    Purity 99%
    Specification 10mg, 20mg
    Appearance White sterile lyophilized powder

     

     Product Advantage 

     


    Why choose us?

    1. All peptides and raws purity >99% purityMany HPLC test reports are available (anoshik).

    2. 100% Safe delivery

    3. Cheapest prices in the market, unbeatable!

    4. Oversea warehouses and stocks: USA, Canada, Europe and Australia.

    5. Payment options: Credit card, bank transfer, wise, alipay, apple pay, google pay, wechat, bitcoin.usdt, Remitly,Money
    gram



     

      FAQ 

     


    Q: How about the price? Can you make it cheaper?
    A: We always take the customer's benefit as the top priority. Price is negotiable under different conditions, we are assuring you to get the most competitive price.

    Q. What's the lead time and shipping ways?
    A: We will delivery to the package by USPS, FEDEX, DHL paket and other dedicated transportation to you after receive your payment, it would take around 10-15 workdays to your address.

    Q: How do i keep the peptides when i receive it ?
    A: Peptides in the form of lyophilized powder can be transported at room temperature by vacuum packaging, while polypeptides in the dissolved state need to be refrigerated at 2°C - 8°C. For long-term storage, peptides should be stored in the form of lyophilized powder store at -20°C or -80°C in a sealed container with desiccant, which can avoid the degradation of peptides to the greatest extent.

    Certificates
    • LL37 Peptide with High quality wholesales peptides 154947-66-7 with high quatity Certificates 1

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    peptide

    Location:

    Room A0693, 6th Floor, Building 3, No.5 Lvtai Road, Zhongtai Subdistrict, Yuhang District, Hangzhou City, Zhejiang Province

    Average lead Time:

    15

    Total Annual Revenue:

    $1 million-$2.5 million

    Total Employees:

    51-100

    Year of Establishment:

    2025

    Hangzhou Zhongbian Technology Co., Ltd. specializes in the R&D and manufacturing of pharmaceutical-grade and healthcare-grade bioactive raw materials and their derivatives, which are widely used in pharmaceuticals, nutraceuticals and cosmetics industries and have gained global recognition for superior bioactivity and safety. Our 100,000-square-meter factory is built in strict compliance with GMP standards, boasting a clean production environment, scientific layout, and complete R&D and manufacturing facilities for deep processing of bioactive raw materials and solvent purification, laying a solid foundation for product quality. We are committed to providing global customers with high-quality products and customized professional solutions, and strive to drive product upgrading across various industries through in-depth cultivation of biotechnology.

    Global Market Reach
    The company's products, with their outstanding quality and stable performance, are exported to over, including the Middle East, South America, North America, Southeast Asia, Africa, Europe, etc., and have accumulated a good reputation in overseas markets. Relying on our professional team and global resource integration capabilities, we fully leverage our geographical and supply chain advantages, continuously optimize localized operations, and effectively help customers reduce costs and improve efficiency while ensuring high-quality products.

    Engaged in Raw Materials for 10+ Years
    We are a biotech enterprise engaged in the R&D, production, and sales of peptides and raw materials for more than 10 years.  The company has complete experimental facilities. Advanced testing instruments ensure the stability of product quality from all aspects. If you're interested in our products, don't hesitate to contact us.

  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.