 Home > Biochemical Engineering > Polypeptide > LL-37 for Sale > LL37 Sterile lyophilized peptide, over 99% purity, direct from the factory, can be shipped worldwide, COA quality certificate

LL37 Sterile lyophilized peptide, over 99% purity, direct from the factory, can be shipped worldwide, COA quality certificate buy - large image1

LL37 Sterile lyophilized peptide, over 99% purity, direct from the factory, can be shipped worldwide, COA quality certificate buy - image1

LL37 Sterile lyophilized peptide, over 99% purity, direct from the factory, can be shipped worldwide, COA quality certificate buy - image2

LL37 Sterile lyophilized peptide, over 99% purity, direct from the factory, can be shipped worldwide, COA quality certificate buy - image3

LL37 Sterile lyophilized peptide, over 99% purity, direct from the factory, can be shipped worldwide, COA quality certificate buy - image4

LL37 Sterile lyophilized peptide, over 99% purity, direct from the factory, can be shipped worldwide, COA quality certificate

Name: LL37 Sterile lyophilized peptide, over 99% purity, direct from the factory, can be shipped worldwide, COA quality certificate
Brand: huilong
SKU: pr2609301568
Price: 99 USD
Availability: InStock

COA TDS 4 Inquiries

Unit Price:

$99-105/UNIT FOB

Get Latest Price 

CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

shenzhen

Brand:

huilong

Packaging:

100mg/a bottle

Sample Available:

Yes

Price valid (until):

2026-10-30

Contact Supplier

 Chat Now

Hulong Biotechnology Co., Ltd

Company Type:

Trader

Location:

China

Payment Terms:

TT against copy of documents,D/P,L/C,D/A,O/A,TT against B/L draft before shipment,100% TT in advance

Average Lead Time:

7 days

Qualification:

Main Products:

polypeptide,Retatrutide,Tirzepatide,Semaglutide,Glow,Benzyl Alcohol

 Visit Store

Product Details
Seller Information
Inquiry History

Description
Legal Polypeptide Product Detailed Description

Our legal polypeptide product is a high-quality, professionally manufactured sterile lyophilized powder, strictly produced and tested to meet international industry standards, with product quality as our core competitive advantage. Sourced directly from our certified source factory, this polypeptide powder boasts an ultra-high purity of over 99%, ensuring stable chemical properties, excellent biological activity, and zero impurity interference, which lays a solid foundation for its safe and efficient application in various fields. Every batch of products undergoes rigorous sterile treatment and multi-layer quality inspection throughout the production process, completely eliminating bacterial contamination and quality fluctuations, and delivering consistent, reliable product performance for global customers.

In terms of quality certification and supply flexibility, our products are fully compliant with international quality norms, with official COA quality certification provided for each batch, covering detailed test data of purity, sterility, composition and safety, enabling customers to verify product quality at any time and use the products with full confidence. As a direct manufacturer, we eliminate intermediate distributors, guarantee authentic product sources, stable supply capacity and competitive factory prices. We support flexible minimum order quantity policies to meet the diverse procurement needs of small batch trial orders and large batch bulk purchases for global clients. Meanwhile, we provide one-stop OEM and ODM customized packaging services, supporting personalized customization of packaging specifications, logos, labels and outer packaging according to customers’ brand positioning and market demands, helping customers build exclusive brand products efficiently.

We offer comprehensive and worry-free global trading and after-sales services to optimize the procurement experience for every customer. Adopting the DDP international trade term, we take full responsibility for double customs clearance procedures, completely saving customers from complex customs declaration, tariff payment and customs clearance risks. We provide full door-to-door delivery services covering the whole process from factory warehouse to designated customer address, paired with efficient and fast global transportation solutions to shorten delivery cycles and ensure timely product delivery worldwide. In terms of payment, we support multiple secure and convenient remittance methods to adapt to different regional transaction habits of global customers. Additionally, we have a professional after-sales service team to provide long-term targeted technical support and problem-solving services, with a perfect after-sales guarantee system to fully protect customers’ legitimate rights and interests in procurement and cooperation.

In summary, this legal polypeptide product stands out in the market relying on its core strengths of 99%+ high purity, sterile lyophilized technology, authoritative quality certification and factory direct supply. With flexible customization solutions, convenient global logistics, diversified payment options and reliable after-sales protection, we provide high-cost-effective, high-quality and one-stop procurement services for global customers, and have become a trusted long-term cooperative supplier for polypeptide product purchasers around the world.

Items Specifications

LL37 5mg*10vials

ECHEMI Editorial Reference

LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.
Research & Reference Note

LL37 Sterile lyophilized peptide, over 99% purity, direct from the factory, can be shipped worldwide, COA quality certificate is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.
Authoritative sources

PubChem

ClinicalTrials.gov

FDA Drugs@FDA

NIH
Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals
Certificates
- TDS
Basic Info

Product Name:
LL-37

Other Name:
Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

CAS No.:
154947-66-7

Molecular Formula:
C205H340N60O53

InChIKeys:
POIUWJQBRNEFGX-XAMSXPGMSA-N

Molecular Weight:
0

EC Number:
211-519-9

Color/Form:
White to off-white

Categories:
Polypeptide

Characteristics

Water Solubility:
Soluble to 1 mg/ml in water
Seller Information

Business Type:
Trader

Main Products:
polypeptide,Retatrutide,Tirzepatide,Semaglutide,Glow,Benzyl Alcohol

Location:
Room 1403, 3/4, Qinglin Building, South of Dongjiang Road, Hexi District, Tianjin

Payment Terms:
TT against copy of documents,D/P,L/C,D/A,O/A,TT against B/L draft before shipment,100% TT in advance

Average lead Time:
7 days

Total Annual Revenue:
$5 million-$10 million

Total Employees:
51-100

Year of Establishment:
2026

Company Certificates
- COA
- COA
- COA
- COA
- COA
- COA
Company Profile

Inquiry History

4 Inquiries

Country	Product	Purchase Quantity	Date Posted
Indonesia	LL 37	1	Aug 6, 2026
United States	LL-37	10 MG	Oct 17, 2026
Indonesia	LL 37	1	Aug 6, 2026
Indonesia	LL-37	5 MG	Jun 23, 2026

Post an enquiry for this product

More Choices Find All Products for Sale 

Product Name	Grade / Content	Price	Supplier Name	Details
Pharmaceutical Grade Peptide ll37 Powder 5mg LL37 CAS 154947-66-7 LL-37	Pharmaceutical Grade/99	$45/UNIT FOB	Haikou Mingheng	Inquiry
LL37 \| US Warehouse \| Cosmetic Peptides \| 99% Purity \| 5mg -10mg Vials 356210	Industrial Grade/99	$23-24/MT FOB	Hong Kong Being Honest Trading Limited	Inquiry
Hot sale Factory Wholesale Price LL-37 99% white powder peptide Weight Lose	Pharmaceutical Grade/99	$100/UNIT FOB	Hangzhou Zhongma Peptide	Inquiry
LL37 5mg	Pharmaceutical Grade/99	$80-85/UNIT FOB	Guangzhou Chengxin International Trade Co., Ltd.	Inquiry
LL-37/SNAP-8/TBHigh-purity and high-quality antibacterial research peptides. Available worldwide. Reliable merchants you can trust.	Cosmetics Grade/99.9	$36/UNIT FOB	dashu	Inquiry

LL37 Sterile lyophilized peptide, over 99% purity, direct from the factory, can be shipped worldwide, COA quality certificate

Product Details

Seller Information

Inquiry History

More Choices Find All Products for Sale 

Related Searches

More from this Seller

Items	Specifications
LL37	5mg*10vials