Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Antibacterials > LL-37 for Sale > LL-37/SNAP-8/TBHigh-purity and high-quality antibacterial research peptides. Available worldwide. Reliable merchants you can trust.
LL-37/SNAP-8/TBHigh-purity and high-quality antibacterial research peptides. Available worldwide. Reliable merchants you can trust. buy - large image1
LL-37/SNAP-8/TBHigh-purity and high-quality antibacterial research peptides. Available worldwide. Reliable merchants you can trust. buy - image1
LL-37/SNAP-8/TBHigh-purity and high-quality antibacterial research peptides. Available worldwide. Reliable merchants you can trust. buy - image2
LL-37/SNAP-8/TBHigh-purity and high-quality antibacterial research peptides. Available worldwide. Reliable merchants you can trust. buy - image3
LL-37/SNAP-8/TBHigh-purity and high-quality antibacterial research peptides. Available worldwide. Reliable merchants you can trust. buy - image4
LL-37/SNAP-8/TBHigh-purity and high-quality antibacterial research peptides. Available worldwide. Reliable merchants you can trust. buy - image5
LL-37/SNAP-8/TBHigh-purity and high-quality antibacterial research peptides. Available worldwide. Reliable merchants you can trust. buy - image6

LL-37/SNAP-8/TBHigh-purity and high-quality antibacterial research peptides. Available worldwide. Reliable merchants you can trust.

TDS 3 Inquiries

Unit Price:

$36/UNIT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Cosmetics Grade

Content:

99.9%

Port:

shenzhen

Brand:

DS

Packaging:

5mg*10vials 10mg*10vials 20mg*10vials

Price valid (until):

2027-10-11

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Medical and health products,Peptide products,Chemical organic, drug intermediate

  • Product Description

  • Seller Information

  • Inquiry History

  • Description
        • WHATSAPP: 852 51862678
        •                        852 5187 9496
        •                       85251879496
        •                      85260902146
        •                      85252045081
        •                       85261524303

        • Introduction:
          Copper peptide powder is a compound that combines copper ions with small protein fragments called peptides. It is commonly used in skincareformulations due to its potential benefits for skin health and appearance.
        • Function:
          1. Improve dynamic wrinkles, relaxing muscles
                                                                        2. Anti-carbonylation, Antioxidation, Anti-saccharification, mainly used in cosmeti
        •   3. Promote rapid wound healing
          4. Widely used as cosmetic additive
        • The importance of peptides:
        • Many active substances in the human body are in the form of peptides. Peptides are involved in various fields of human hormones, nerves, cell growth and reproduction, and their importance is to regulate the physiological functions of various systems and cells in the body, activate the relevant enzyme systems in the body, promote the permeability of intermediate metabolic membranes, or control DNA transcription or affect specific protein synthesis, and ultimately produce specific physiological effects. Peptides are important substances involved in various cell functions in human body. Peptides can be synthesized into cells and regulate their functional activities. Peptides act as neurotransmitters in the body, transmitting information.

    • Shop High Quality Cosmetics Peptides Anti-Aging Copper Peptide Powder CAS 49557-75-7 Ghk-Cu-Detailed Image 1

    • Shop LL-37/SNAP-8/TBHigh-purity and high-quality antibacterial research peptides. Available worldwide. Reliable merchants you can trust.-Detailed Image 2 Shop LL-37/SNAP-8/TBHigh-purity and high-quality antibacterial research peptides. Available worldwide. Reliable merchants you can trust.-Detailed Image 3
    • Shop LL-37/SNAP-8/TBHigh-purity and high-quality antibacterial research peptides. Available worldwide. Reliable merchants you can trust.-Detailed Image 4 Shop LL-37/SNAP-8/TBHigh-purity and high-quality antibacterial research peptides. Available worldwide. Reliable merchants you can trust.-Detailed Image 5
    • LL-37 (the only Cathelicidin antibacterial peptide in the human body) Basic parameters
      CAS Number: 154947-66-7
      Alternative Names: Cathelicidin, CAP-18
      Molecular Weight: 4493 Da, consisting of 37 amino acids. It is named due to the presence of two leucine residues at the beginning.
      Raw Material Properties: Research-grade peptide raw material, intended solely for laboratory research. It cannot be injected privately or used externally for medicinal purposes.
      Detailed Explanation of Core Effects
      1. Broad-spectrum antibacterial, disintegrating bacterial biofilms
      Killing Gram-positive bacteria, Gram-negative bacteria, drug-resistant strains, fungi, enveloped viruses, parasites
      Penetrating bacterial cell membranes, neutralizing bacterial endotoxin LPS, alleviating severe inflammation caused by toxins
      Dissolving stubborn bacterial biofilms, suitable for repeated difficult-to-heal wounds, oral periodontal infections
      2. Bidirectional immune regulation
      Recruiting neutrophils, monocytes, and immune T cells to the affected area, activating innate immunity
      Regulating inflammatory factors, inhibiting excessive inflammatory storms, improving chronic inflammation in the skin and internal organs
      Vitamin-D can activate the body's synthesis of LL-37, which is also a key medium for enhancing immunity by vitamin D
      3. Accelerating wound healing and skin regeneration
      Promoting the migration of epidermal keratinocytes and the growth of new blood vessels, accelerating wound scab formation and healing
      Used in related research trials for diabetic foot ulcers, damaged skin, mucosal wounds
      Reducing scar formation, promoting complete repair of epithelial tissues
      4. Multi-tissue repair effects
      Oral periodontal: Improving periodontitis, gum wounds, inhibiting oral pathogenic bacteria
      Bone repair: Inducing stem cell differentiation, assisting in bone defect and bone injury repair
      Respiratory tract, gastrointestinal mucosal protection, protecting mucosal barriers, reducing the probability of respiratory tract infections
      5. Additional research directions
      Participating in tumor cell regulation, mechanism research of skin diseases (psoriasis), lung injury protection, anti-pathogen invasion, etc. direction experiments
    • Shop LL-37/SNAP-8/TBHigh-purity and high-quality antibacterial research peptides. Available worldwide. Reliable merchants you can trust.-Detailed Image 6 Shop LL-37/SNAP-8/TBHigh-purity and high-quality antibacterial research peptides. Available worldwide. Reliable merchants you can trust.-Detailed Image 7

    A corner of the company

    Shop LL-37/SNAP-8/TBHigh-purity and high-quality antibacterial research peptides. Available worldwide. Reliable merchants you can trust.-Detailed Image 8 Shop LL-37/SNAP-8/TBHigh-purity and high-quality antibacterial research peptides. Available worldwide. Reliable merchants you can trust.-Detailed Image 9

    Product real photo

    Shop LL-37/SNAP-8/TBHigh-purity and high-quality antibacterial research peptides. Available worldwide. Reliable merchants you can trust.-Detailed Image 10 Shop LL-37/SNAP-8/TBHigh-purity and high-quality antibacterial research peptides. Available worldwide. Reliable merchants you can trust.-Detailed Image 11 Shop LL-37/SNAP-8/TBHigh-purity and high-quality antibacterial research peptides. Available worldwide. Reliable merchants you can trust.-Detailed Image 12 Shop LL-37/SNAP-8/TBHigh-purity and high-quality antibacterial research peptides. Available worldwide. Reliable merchants you can trust.-Detailed Image 13
    product certification
    Shop LL-37/SNAP-8/TBHigh-purity and high-quality antibacterial research peptides. Available worldwide. Reliable merchants you can trust.-Detailed Image 14 Shop LL-37/SNAP-8/TBHigh-purity and high-quality antibacterial research peptides. Available worldwide. Reliable merchants you can trust.-Detailed Image 15


    Items Specifications
    Tirzepatide Independent vacuum packaging, white powder

    5mg*10vials   10mg*10vials    15mg*10vials    20mg*10vials    30mg*10vials    40mg*10vials  50mg*10vials

    Refrigeration treatment  Shelf life: 3 years


    Why choose us?

    Professional, Rich Experience.

    1)Rich experience for Europe&North America&South America&Middle East&Asiaexport.

    2)Full experience of large numbers containers loading in Chinese sea port.


    Our Advantages.

    1)All purity>99%.

    2)High quality with competitive price.

    3)We are manufacturer and can provide high quality products with factory price.


    Fast and safe delivery.

    1)Parcel can be sent out in 24 hours after payment tracking number available.

    2)Secure and discreet shipment verious transportation methods for your choice.

    3)Customs pass rate >99%.

    We have clients throughout the world.

    1)Professional service and rich experience make customers feel at ease, adequate stock and fast delivery meet their different desire.

    2)Market feedback and goods feedback will be appreciated, meeting customers' requirement is our principal responsibility.

    3)High quality, competitive price, fast delivery, first-class service gain the trust and praise from all the customers.


    How to proceed your order:

    Step 1:Please let me know the items you are favorable, quantities, and the destination country.

    Step 2:You confirm all detail, and offer purchasing order.

    Step 3:We send the detail price of our product and offer the suitable shipping method for reference.

    Step 4:You confirm the order and payment 100% in advance and send us the detailed contacting information, including contacting person/company,address,mobile number,ZIP code and your special requirements.

    Step5:We arrange the shipment according to your requirements, and tracking code will be offered once it is released, then you can track your parcel at any moment.

    Step 6:We offer after-sales services after service after you receive your parcel

    ...Shop Tirzepatide  high purity-Detailed Image 6

    ECHEMI Editorial Reference
    LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.
    Research & Reference Note

    LL-37/SNAP-8/TBHigh-purity and high-quality antibacterial research peptides. Available worldwide. Reliable merchants you can trust. is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals

    Certificates

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Antibacterials

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Medical and health products,Peptide products,Chemical organic, drug intermediate

    Location:

    Room 210, 2nd Floor, Office Building No.1, Dezhou Fushite Electric Motor Co., Ltd., North of Xiaoli Road and West of Tianlong Village, Tianqu Sub-district Office

    Payment Terms:

    100% TT in advance

    Average lead Time:

    15

    Total Annual Revenue:

    $5 million-$10 million

    Total Employees:

    51-100

    Year of Establishment:

    2026

    Certifications:

    COA,COA

    Dashu Biotechnology Co., Ltd. was founded in July 2026. We specialize in a variety of health care products.
    The company attaches great importance to product quality control and implements standardized quality control standards. All products undergo strict testing, supported by complete documents including COA and MSDS.
    Relying on a stable supply chain system, we provide cost-effective products for global customers. Adhering to the principle of integrity and pragmatism, we look forward to establishing long-term and stable partnerships with purchasers worldwide.

  • Inquiry History
    3 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.