LL-37 Cathelicidin Peptide 99% HPLC Lyophilized Powder Human Antimicrobial Host Defense Peptide With COA For Lab Research Only

Sales manager: Nyra
whatsapp：+86 18830996705
Email: Nyra@hzzmtrade.cn

Product Name: LL-37 / Cathelicidin

Sequence: [LL-37, 37 aa]

Purity: ≥99% by HPLC

Molecular Weight: 4493.3 Da

Appearance: White Lyophilized Powder

Storage: -20℃, sealed and protected from light

Solubility: Soluble in water

Application: Laboratory research only

Certificate: COA, HPLC, MS

Quick Guide:

1. Mass production customize available.

2. Cap color customize, please ask our sales rep. for more color plans.

3. Vial size and mg content size customize

4. Shipping channels secure.

5. Vaccum seal for all of vials. 

6. Fresh batch every 6-8 days. 

Peptide Storage Guidelines General Tips
When storing peptides, remember to:
• Store peptide in a cold, dry, dark place
• Avoid repeated freezing and thawing of peptide
• Avoid overexposure to the air
• Avoid light exposure
• Avoid storing peptides in solution long term
• Aliquot peptide according to experimental requirements

1. 1.High-Purity Research Material
   Designed for laboratory research, analytical testing, and method development.

2. 2.Clear Specification Options
   Available in 5 mg per vial to support different research needs.

3. 3.White Lyophilized Powder
   Supplied as a stable white powder in clear glass vials.

4. 4.Individual Vial Protection
   Each vial is independently sealed for convenient storage and handling.

5. 5.10 Vials per Tray
   Protective 10-vial packaging supports organized inventory management and transport.

6. 6.Batch Documentation Available
   COA and relevant batch information can be provided upon request.

7. 7.Custom Packaging Support
   Label, specification, and packaging customization options are available for qualified orders.

8. 8.Research Use Only
   Supplied strictly for laboratory research and analytical use, not for human or veterinary use.

We are a source‑manufacturing factory with well‑established production, R&D and quality control systems. We support mass production as well as small‑batch customization. Our raw materials feature consistent purity with complete test reports available. As direct factory supply, we eliminate middleman mark‑ups to deliver outstanding cost‑performance. Lead times are controllable with sufficient stock for fast delivery. Customized packaging and labeling services are available for clients. Equipped with solid practical export experience, we are familiar with various export logistics and documentation, providing overseas customers with stable and reliable one‑stop supply services.

  Hangzhou Zhongma Technology Co., Ltd.Located in Hangzhou, China, Hangzhou Zhongma Technology Co., Ltd. is a professional foreign‑trade enterprise focusing on cross‑border supply‑chain services. We cooperate closely with qualified manufacturing factories, mainly engaged in overseas export of peptide raw materials and lyophilized powder products,Serving business partners around the world .
  We run a full‑link service covering raw‑material screening, production quality control, order processing, multiple payment options and international logistics delivery. Supported by GMP‑standard clean‑workshop facilities from our partner factories, every production procedure is strictly inspected to guarantee stable product quality. Our professional foreign‑trade team offers fast‑track inquiry response. Multiple payment methods are available, together with diversified shipping solutions including DHL, UPS, FedEx and US Special Line.
  Adhering to the service philosophy of Customer‑Oriented & Quality‑Driven, we attach great importance to product quality and on‑time delivery. We respect personalized requirements from clients worldwide, and commit ourselves to delivering reliable, efficient one‑stop foreign‑trade solutions for long‑term win‑win cooperation.

  With years of in‑depth experience in peptide‑product cross‑border export, Hangzhou Zhongma Technology Co., Ltd. has built a mature global supply‑chain system and achieved solid progress.

packing：

Research-grade lyophilized peptide powders, sealed glass vials with full batch documents.

Shockproof & insulated packaging to guarantee product quality on the way.

Factory direct, stock available, fast global shipment.

We have long-term cooperation with reliable international logistics carriers, including DHL, FedEx, UPS and dedicated line channels. We will select the most suitable shipping solution according to destination country, package weight and customs policy. All packages are packed discreetly. The outer package uses neutral packing without sensitive marks. Inner packaging adopts shockproof and temperature-protective materials to keep peptides stable during transit. We will provide tracking number once goods dispatched. You can track the parcel status online in real time. We have rich export experience for peptide raw materials. Our team will assist with customs documents and try our best to reduce customs detention risk. Delivery time varies by region, normally 5–12 working days.

Multiple secure payment methods are available, including Bank Transfer, Wise, USDT / BTC and other options. We do not collect any unnecessary private information. All transactions follow formal business rules. We will confirm order details before payment. After receiving payment, we arrange production and shipment accordingly. We maintain complete order records for every transaction. If you have any questions about orders or payments, our sales team is ready to offer support promptly.

Q1: Can I get a sample before placing an order?
A1: Yes, we can provide samples. You only need to pay for shipping and the sample fee.

Q2: When will my order ship after payment?
A2: Most orders ship within two business days.

Q3: Delivery Time and Shipping Methods

A3: After we receive your payment, we will ship your package via our dedicated U.S. shipping route, FedEx, or DHL Express. Delivery is expected to take approximately 5 to 10 days.

Q4: What are the payment methods?
A4: We accept payments via U, bank transfer, Wise, and B.

Q5: Are prices negotiable?

A5：Yes. We are committed to offering our customers competitive prices. The final quotation may vary depending on the selected TR specifications, purchase quantity, packaging requirements and other order details. Please contact us for an accurate quotation.