pharmaceutical peptide ACTH(1-39) / Corticotropin 98%
9002-60-2
Pharmaceutical Grade
98%
SHANGHAI
0.001kg/0.10kg Bottle
2018-12-31
Cosmetic raw material, peptide, API
-
Product Description
-
Seller Information
-
Description
ACTH(1-39), Corticotropin
Cas No: 9002-60-2
Formula: C207H308N56O58S
Molecular: 4541.0658
Sequence: SYSMEHFRWGKPVGKKRRPVKVYPDGAEDQLAEAFPLEF
Purity:98%
Appearance: white powder
Source: synthetic
Also known as: Adrenocorticotropin, ACTH, Corticotrophine, Corticotrofina, Cortrophin, Corticotrophinum
ECHEMI Editorial ReferenceChEBI: A polypeptide hormone produced and secreted by the pituitary gland comprising 39 amino acid residues coupled in a linear sequence. The N-terminal 24-amino acid segment is identical in all species and contains the adrenocorticotrophic act vity. Corticotropin stimulates the cortex of the adrenal gland and boosts the synthesis of corticosteroids, mainly glucocorticoids but also sex steroids (androgens). It is used in the treatment of certain neurological disorders such as infantile spasmsResearch & Reference Notepharmaceutical peptide ACTH(1-39) / Corticotropin 98% is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.
Authoritative sourcesDisclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.
Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals
Basic Info-
Product Name:
Corticotropin
Other Name:Corticotropin;Acethropan;Acorto;ACTH;Acton;Actonar;Adrenal cortex hormone;Adrenocorticotrophic hormone;Adrenocorticotrophin;Adrenomone;Cibacthen;Corstiline;Cortiphyson;Cortrophin;Reacthin;Solacthyl;Adrenocorticotropic hormone;Adrenocorticotropin;Corticotropin-like substances;Dynamone;Exacthin;Adrenotrophin;Corticotrophin;Duracton;ProActon;Humactid;Nuvacthen;Chorionic corticotropin;Acthormone;Adrenocorticotropin hormone;Acton (hormone);Cortrophimn;Tubex;Acortan;Alfatrofin;Isactid;8049-43-2;8049-37-4;8049-87-4;8049-68-1;8049-86-3;9006-61-5;9040-10-2;55127-96-3
CAS No.:9002-60-2
InChIKeys:IDLFZVILOHSSID-OVLDLUHVSA-N
Molecular Weight:4541.1
Exact Mass:4538.26000
EC Number:232-659-7
HScode:2937190000
Characteristics-
PSA:
1861.55000
XLogP3:5.65470
Appearance:powder
Water Solubility:H2O: 1 mg/mL, clear, colorless
Storage Conditions:−20°C
Flammability characteristics:Combustible
Hazard IdentificationClassification of the substance or mixture
Acute toxicity - Category 4, Oral
Acute toxicity - Category 4, Dermal
Acute toxicity - Category 4, Inhalation
Carcinogenicity, Category 2
GHS label elements, including precautionary statements
Pictogram(s) 
Signal word Warning
Hazard statement(s) H302 Harmful if swallowed
H312 Harmful in contact with skin
H332 Harmful if inhaled
H351 Suspected of causing cancer
Precautionary statement(s) Prevention P264 Wash ... thoroughly after handling.
P270 Do not eat, drink or smoke when using this product.
P280 Wear protective gloves/protective clothing/eye protection/face protection/hearing protection/...
P261 Avoid breathing dust/fume/gas/mist/vapours/spray.
P271 Use only outdoors or in a well-ventilated area.
P203 Obtain, read and follow all safety instructions before use.
Response P301+P317 IF SWALLOWED: Get medical help.
P330 Rinse mouth.
P302+P352 IF ON SKIN: Wash with plenty of water/...
P317 Get medical help.
P321 Specific treatment (see ... on this label).
P362+P364 Take off contaminated clothing and wash it before reuse.
P304+P340 IF INHALED: Remove person to fresh air and keep comfortable for breathing.
P318 IF exposed or concerned, get medical advice.
Storage P405 Store locked up.
Disposal P501 Dispose of contents/container to an appropriate treatment and disposal facility in accordance with applicable laws and regulations, and product characteristics at time of disposal.
Other hazards which do not result in classification
no data available
Handling and StoragePrecautions for safe handling
Handling in a well ventilated place. Wear suitable protective clothing. Avoid contact with skin and eyes. Avoid formation of dust and aerosols. Use non-sparking tools. Prevent fire caused by electrostatic discharge steam.
Conditions for safe storage, including any incompatibilities
Store the container tightly closed in a dry, cool and well-ventilated place. Store apart from foodstuff containers or incompatible materials.
-
-
Seller Information
-
Business Type:
Distributor
-
Main Products:
Cosmetic raw material, peptide, API
-
Location:
6,23th FL,Building 1,No 666,Jitai Rd,New and Hi-tech zone,Chengdu,China 610000
-
Payment Terms:
TT against copy of documents
-
Average lead Time:
60
-
Total Annual Revenue:
$2.5 million-$5 million
-
Total Employees:
11-50
-
Year of Establishment:
2015
Chengdu YoungShe Chemical Co., Ltd. was established in 2015. It is a new and dynamic high-tech enterprise that continuously innovates and specializes in the research, development, production and sales of peptide cosmetic raw materials. It has customers all over the world. Chengdu Yunxi, heart to heart, heart peptide, and heart service. After several years of research, Chengdu Yunxi has developed hundreds of cosmetic peptides with various functions, basically covering all commercially available cosmetic peptide varieties. Chengdu Youngshe Chemical Co., Ltd. as a domestic professional supplier of cosmetic peptide raw materials, our cosmetic peptides mainly include: breast enhancement peptide (Liptide), light skin peptide (Lightide), whitening peptide (Whitide) 、Lashtide、Argitide、Eyelitide、Eyestide、Matritide、Matritide3000、Collatide and hair growth peptide (Hairtide), Copper Peptide, Desentide, Calmtide, Rebasetide, Deretide, Moistide, Despotide ), Elastide, Descartide, Snaptide, Aketide, Carnosine, EGF peptide, Ingactide, young peptide ( youngtide, Firmtide, Stretide, Keratide, Antiuvtide, Lashtide-plus, Eyestide-Plus , Compound whitening peptide (Whitide-Plus), Compound wrinkle-Plus, Compound anti-allergic peptide (Desentide-Plus), Compound repair peptide (Repair-Plus), etc. Quality, service and credibility are Yunxi's corporate purpose and fundamental survival, and customer satisfaction is Yunxi's ultimate goal. Regardless of whether you have used Chengdu Yunxi's beauty peptide products, each of our employees will welcome your consultation with sincerity and enthusiasm. Chengdu Yunxi, your reliable partner for beauty peptides.
-
-
Country Product Purchase Quantity Date Posted Post an enquiry for this product
