LL37 Peptide cas 154947-66-7
3 Inquiries
154947-66-7
Pharmaceutical Grade
99%
qingdao
Xinli
5mg*10vials
Yes
2026-02-28
ghk-cu,Semaglutide,tirzepatide,Retatrutide
-
Product Description
-
Seller Information
-
Inquiry History
-
DescriptionECHEMI Editorial ReferenceLL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.Research & Reference Note
LL37 Peptide cas 154947-66-7 is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.
Authoritative sourcesDisclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.
Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals
Basic Info-
Product Name:
LL-37
Other Name:Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate
CAS No.:154947-66-7
Molecular Formula:C205H340N60O53
InChIKeys:POIUWJQBRNEFGX-XAMSXPGMSA-N
Molecular Weight:0
EC Number:211-519-9
Color/Form:White to off-white
Categories:
Characteristics-
Water Solubility:
Soluble to 1 mg/ml in water
-
-
Seller Information
-
Business Type:
Trader
-
Main Products:
ghk-cu,Semaglutide,tirzepatide,Retatrutide
-
Location:
Room 68-5-501, Lianqiang Residential Area, No. 371 Union Road, Union Street, Xinhua District, Shijiazhuang City, Hebei Province
-
Payment Terms:
TT against copy of documents,100% TT in advance
-
Average lead Time:
5 days
-
Total Annual Revenue:
Less than $1 million
-
Total Employees:
5-10
-
Year of Establishment:
2022
-
-
Inquiry History3 Inquiries
Country Product Purchase Quantity Date Posted 
Indonesia
LL 37
1 Aug 6, 2026
Indonesia
LL 37
1 Aug 6, 2026
Indonesia
LL-37
5 MG Jun 23, 2026 Post an enquiry for this product
More from this Seller
-
-
![High quality Freeze dried Powder Bodybuilidng Peptide Peptide Dermorphin CAS77614-16-5]( "High quality Freeze dried Powder Bodybuilidng Peptide Peptide Dermorphin CAS77614-16-5")
-
High quality Freeze dried Powder Bodybuilidng Peptide Peptide Dermorphin CAS77614-16-5
Top Grade / 99%
$30/UNIT FOB
-
-
-
![Retatrutid peptide]( "Retatrutid peptide")
-
Retatrutid peptide
Chemical Grade / 99%
-
-
-
![High Quality Peptides IGF-1LR3 Powder CAS 946870-92-4 IGF1 Test prop]( "High Quality Peptides IGF-1LR3 Powder CAS 946870-92-4 IGF1 Test prop")
-
High Quality Peptides IGF-1LR3 Powder CAS 946870-92-4 IGF1 Test prop
Pharmaceutical Grade / 99%
-
-
-
![Gs441524 reagents, powders]( "Gs441524 reagents, powders")
-
Gs441524 reagents, powders
Pharmaceutical Grade / 99%
-
-
-
![99% High Purity Anti-aging Raw Material Powder Vials Peptide]( "99% High Purity Anti-aging Raw Material Powder Vials Peptide")
-
99% High Purity Anti-aging Raw Material Powder Vials Peptide
Cosmetics Grade / 99.9%
-
-
-
![Most Hot Selling Bodybuiling Fat Reduce Peptide 10mg 20mg Tren e]( "Most Hot Selling Bodybuiling Fat Reduce Peptide 10mg 20mg Tren e")
-
Most Hot Selling Bodybuiling Fat Reduce Peptide 10mg 20mg Tren e
Pharmaceutical Grade / 99.9%
-
