Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > LL37 99% freeze dried powder
LL37 99% freeze dried powder buy - large image1
LL37 99% freeze dried powder buy - image1
LL37 99% freeze dried powder buy - image2
LL37 99% freeze dried powder buy - image3
LL37 99% freeze dried powder buy - image4
LL37 99% freeze dried powder buy - image5
LL37 99% freeze dried powder buy - image6

LL37 99% freeze dried powder

TDS 1 Inquiries

Unit Price:

$11.07/MT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99.9%

Port:

shanghai

Brand:

LL37

Packaging:

2mg, 5mg 10mg 15mg 30mg Per Vial, 10vials/box

Price valid (until):

2026-07-15

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Peptide,sterile water

  • Product Description

  • Seller Information

  • History Price

  • Inquiry History

  • Description


      Product Detail  


    contact name : lily
    WhatsApp or telegram:  +852 90843541
    Email: sales04@sdchangxu.cn

    Retatrutide (LY-3437943) is an experimental drug for obesity . It is a triple hormone receptor agonist of GLP-1GIP, and GCGR receptors. It has been shown to achieve a more than 24% mean weight reduction in non-diabetic obese or overweight adults during a phase 2 trial. The drug is a peptide with amino acid sequence YA1QGTFTSDYSIL2LDKK4AQA1AFIEYLLEGGPSSGAPPPS3.

    Clinical data
    Other names LY-3437943
    Identifiers

    CAS Number
    UNII
    • NOP2Y096GV
    ChEMBL
    • ChEMBL5095485
    Chemical and physical data
    Formula C 223 H 343 F 3 N 46 O 70
    Molar mass 4845.444 g·mol−1
    Product name Customize Peptides
    Purity 99%
    Appearance White powder
    Application Healthcare
    Package 1box=10 vials,or 1g/bottle
    Storage Store in refrigerator at 4°C, tightly sealed, away from heat, light and moisture.
    Retest Date 2 years


    Shop Mots-C in stock-Detailed Image 1


    Shop Mots-C in stock-Detailed Image 2
    Shop Mots-C in stock-Detailed Image 3
    Shop Mots-C in stock-Detailed Image 4
    Shop Mots-C in stock-Detailed Image 5
    Shop Mots-C in stock-Detailed Image 6

    Shop Mots-C in stock-Detailed Image 7
    Shop Mots-C in stock-Detailed Image 8
    Shop Mots-C in stock-Detailed Image 9
    Shop Mots-C in stock-Detailed Image 10

    Function

    1. 1.Treatment of depression and anxiety disorders: Retatrutide has been shown to have antidepressant and anxiolytic effects in preclinical studies, suggesting that it could be a promising treatment option for individuals with these conditions.
    2. 2.Prevention of neurodegenerative diseases: Retatrutide has neuroprotective properties that may be useful in preventing or slowing the progression of neurodegenerative diseases such as Alzheimer's and Parkinson's.
    3. 3.Enhancement of cognitive function: Retatrutide has been shown to improve learning and memory in animal studies, suggesting that it could have potential as a cognitive enhancer in humans.
    4. 4.Treatment of chronic pain: Retatrutide has been shown to have analgesic effects in preclinical studies, suggesting that it could be a useful treatment option for individuals with chronic pain conditions.
    5. 5.Promotion of wound healing: Retatrutide has been shown to accelerate wound healing in animal studies, suggesting that it could have potential as a therapeutic agent for promoting wound healing in humans.

    Application
    1.Retatrutide is often used in the pharmaceutical industry, weight losing, etc.
    2.Retatrutide is a kind of peptide product.
    3.Retatrutide acetate can inhibited GCGR, GIPR and GLP-1R.
    4.Retatrutide acetate is activated by glucagon receptors resulting in significant weight loss and increased energy expenditure.
    5.Retatrutide acetate can be used in studies of obesity.

    RFQ

    Q1: Can I get a sample before placing an order?
    A1: Yes, we can provide samples, you only need to pay the shipping fee and sample fee.
    Q2: What payment methods can your company use?
    A2:Payment can be made by Bitcoin,wire transfer or W U or paypal,You can choose the one that is convenient for you.
    Q3: How long does it take to ship an order?
    A3: We ship the package within 3-7 days with tracking number. Shipping times vary by country. 
    Q4: Why should you buy from us instead of other suppliers?
    A4: Because we are a factory, we can provide lower prices and guaranteed quality. We have extensive experience in domestic and foreign trade and provide services in an honest, timely and efficient manner.
    Q5: How to place an order for each product?
    A5: Please send us an inquiry and let us know your requirements; we will send you a complete quotation including freight, confirm the order and send payment/deposit, we will arrange production or delivery of the goods after receiving the bank receipt.

    Company Profile

    Introduction

    Shandong Changxu Trade Co., Ltd. is an enterprise dedicated to the development, sales, and production of products such as polypeptide reagents,

    intermediates, sterols, and peptide chemicals. We have export experience of 8 years.


    Professional manufacturing plant

    Chnagxu has formulated strict management systems and scientific production processes. lt can synthesize thousands of

    polypeptides with different sequences simultaneously, greatly reducing the comprehensive cost of polypeptide synthesis. As a result, it can provide cost -effective products and services to scientific research users, winning precious research time for customers and reducing their research costs. We have a factory area of 1,500 square meters with around 250 employees. We have product certifications such as FDA and CE.


    Certificates

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Peptide,sterile water

    Location:

    jinan

    Payment Terms:

    TT against copy of documents,TT against B/L draft before shipment,100% TT in advance

    Average lead Time:

    15

    Total Annual Revenue:

    $1 million-$2.5 million

    Total Employees:

    11-50

    Year of Establishment:

    2025

    Shandong Changxu Trade CO., LTD

    our main products are weight loss peptide, anti-wrinkle peptide, tanning titanium, and other products, reliable quality, committed to strict quality control and thoughtful customer service, our experienced staff is always available to discuss your requirements to ensure customer satisfaction. In addition, we have obtained ISO9001 and CE certification. 


      Company Profile  


  • Weekly Price

    The chart shows the price trend of the product in the past 12 months.

  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.