Product
Supplier
Encyclopedia
Inquiry
Home > Active Pharmaceutical Ingredients > Drugs Influencing Immune Function > LL-37 for Sale > Factory Supply LL 37 CAS 154947-66-7 LL-37 peptide raw powder
Factory Supply LL 37 CAS 154947-66-7 LL-37 peptide raw powder buy - large image1
Factory Supply LL 37 CAS 154947-66-7 LL-37 peptide raw powder buy - image1
Factory Supply LL 37 CAS 154947-66-7 LL-37 peptide raw powder buy - image2
Factory Supply LL 37 CAS 154947-66-7 LL-37 peptide raw powder buy - image3
Factory Supply LL 37 CAS 154947-66-7 LL-37 peptide raw powder buy - image4
Factory Supply LL 37 CAS 154947-66-7 LL-37 peptide raw powder buy - image5
Factory Supply LL 37 CAS 154947-66-7 LL-37 peptide raw powder buy - image6

Factory Supply LL 37 CAS 154947-66-7 LL-37 peptide raw powder

TDS 1 Inquiries

Unit Price:

$13-16/UNIT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

any china port

Brand:

TNJONE

Packaging:

1g,10g,50g or according to customer's detail requirement.

Price valid (until):

2026-12-29

Company Type:
Manufactory
Location:
China
Qualification:
Main Products:

Semaglutide,Tirzepatide,API,Vitamins,Food Additive

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


    Factory Supply LL 37 CAS 154947-66-7 LL-37 peptide raw powder


    What is LL-37?


    The cathelicidin anti-microbial peptide LL-37 is involved in the reepithelialization of human skin wounds and is lacking in chronic ulcer epithelium. LL-37(human) is a cathelicidin-derived peptide with antimicrobial and angiogenic activity. Antimicrobial peptide derivative of human cathelicidin

    Antimicrobial peptide derivative of human cathelicidin. Induces FPRL1-mediated chemotaxis of human neutrophils, monocytes and T cells in vitro. Promotes wound healing following skin-targeted electroporation of a plasmid encoding hCAP-18/LL-37 in mice. Also triggers apoptosis in colon cancer cells. Cell permeable.


    The human body mainly produces two types of antimicrobial peptides: defensin family peptides and cathelicidin family peptides. Although there are many members of the defensin family of peptides, cathelicidin has only one antimicrobial peptide product, LL-37. LL-37 is the C-terminal cleavage product of cathelicidin peptide Hcap-18, which directly kills bacteria, fungi and viruses.


    Items Specifications
    Product Name LL-37
    Cas No 154947-66-7
    Einecs 211-519-9
    MF C205H340N60O53
    MW 2180.29
    Appearance white powder
    Shelf Life 2 Years When Properly Stored
    Storage Keep in a cool, dry, dark location in a tightly sealed container or cylinder.


    Shop Wholesale Peptide Teriparatide Powder CAS 52232-67-4 Teriparatide Acetate-Detailed Image 1 Shop Factory Supply LL 37 CAS 154947-66-7 LL-37 peptide raw powder-Detailed Image 2



    Function & Applicaton

    1. Antibacterial effect: LL37 can destroy the cell wall of bacteria and make it die, thus having antibacterial effect. It has antibacterial activity against a variety of gram-positive and Gram-negative bacteria, including drug-resistant bacteria.
    2. Immunomodulatory effects: LL37 can regulate the function of the immune system and promote the resolution and repair of inflammation. It can enhance the activity of monocytes, macrophages and natural killer cells, and promote the regulation and repair process of immune cells in the course of inflammatory disease.
    3. Anti-inflammatory effect: LL37 can reduce inflammatory response, inhibit the activation of inflammatory cells and the release of cytokines. It can regulate the expression of inflammatory mediators, thereby reducing swelling, redness, pain and other symptoms caused by inflammatory responses.
    4. Promote wound healing: LL37 can promote wound healing and tissue repair. It can stimulate epidermal cell proliferation and migration, and promote the speed and quality of wound healing. At the same time, LL37 also has antioxidant and anti-angiogenesis effects, contributing to wound repair and regeneration.


    Company Information 
    Shop High Quality Oxyntomodulin Peptide Glucagon Acetate Powder CAS 16941-32-5 Glucagon-Detailed Image 3






    Certificates
    • Factory Supply LL 37 CAS 154947-66-7 LL-37 peptide raw powder Certificates 1

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Manufactory

    Main Products:

    Semaglutide,Tirzepatide,API,Vitamins,Food Additive

    Location:

    No. 4C-11-A392, Financial Port, Northwest corner of Fengjing Avenue and Fengxin Road, Fengdong New City, Xi 'an, Shaanxi Province

    Payment Terms:

    TT against copy of documents,D/P,L/C,D/A,O/A,TT against B/L draft before shipment,100% TT in advance

    Average lead Time:

    5

    Total Annual Revenue:

    $5 million-$10 million

    Total Employees:

    11-50

    Year of Establishment:

    2019

    Shaanxi TNJONE Pharmaceutical Technology Co., LTD., located in the beautiful ancient capital Xi 'an, is committed to the peptide industry, pharmaceutical raw materials, food and feed additives, veterinary drugs and other fields, the enterprise adhering to provide customers with quality service, supply high-quality products, "world peace and health" as its responsibility, the company adhering to the "meet all customer requirements for products" as the service concept, Guarantee "provide qualified products" as the service principle, so that you get "God-like" noble shopping enjoyment. Our company has more than 1000 kinds of polypeptides, raw materials inventory, at any time to meet the various needs of customers for products. Is your best partner.
  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.