Product
Supplier
Encyclopedia
Inquiry
Home > Active Pharmaceutical Ingredients > Other Chemical Drugs > Teriparatide acetate for Sale > High Quality Factory Supply Low Price Teriparatide Acetate CAS 52232-67-4
High Quality Factory Supply Low Price Teriparatide Acetate CAS 52232-67-4 buy - large image1
High Quality Factory Supply Low Price Teriparatide Acetate CAS 52232-67-4 buy - image1
High Quality Factory Supply Low Price Teriparatide Acetate CAS 52232-67-4 buy - image2
High Quality Factory Supply Low Price Teriparatide Acetate CAS 52232-67-4 buy - image3
High Quality Factory Supply Low Price Teriparatide Acetate CAS 52232-67-4 buy - image4
High Quality Factory Supply Low Price Teriparatide Acetate CAS 52232-67-4 buy - image5
High Quality Factory Supply Low Price Teriparatide Acetate CAS 52232-67-4 buy - image6

High Quality Factory Supply Low Price Teriparatide Acetate CAS 52232-67-4

10 Inquiries

Unit Price: Get Latest Price
CAS No.:

52232-67-4

Grade:

medicinal Grade

Content:

99%

Port:

china any port

Brand:

TNJONE

Packaging:

5mg/10mg/15mg per vial; 1g,10g or according to customer's detail requirement.

Price valid (until):

2025-03-18

Company Type:
Manufactory
Location:
China
Qualification:
Main Products:

Semaglutide,Tirzepatide,API,Vitamins,Food Additive

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


    Product Description


    What is Teriparatide Acetate?
    Teriparatide is a man-made form of parathyroid hormone that exists naturally in the body. Teriparatide increases bone mineral density and bone strength, which may prevent fractures.Teriparatide is used to treat osteoporosis caused by menopause, steroid use, or gonadal failure. teriparatide is for use when you have a high risk of bone fracture due to osteoporosis.Teriparatide may also be used for purposes not listed in this medication guide.
    Shop High Quality Factory Supply Low Price Teriparatide Acetate CAS 52232-67-4-Detailed Image 1 Shop High Quality Factory Supply Low Price Teriparatide Acetate CAS 52232-67-4-Detailed Image 2 Shop High Quality Factory Supply Low Price Teriparatide Acetate CAS 52232-67-4-Detailed Image 3

    Name Teriparatide Acetate
    CAS NO. 52232-67-4
    purity over 99%
    Standard packing material Bag/Box/Bottle
    Appearance White Fine Powder
    Storage

    Lyophilized peptides although stable at room temperature for 3 months, should be stored 

    desiccatedbelow-20°C. Upon reconstitution of the peptide it should be stored at 4° C between 2-21 days and for future use below -20°C. 

    Shelf life

    24 months



    Applications:

    • 1.Artichoke extract is also reputed to relieve flatulence.
      2.Has the function of treating digestive upset, poor liver function, and arange of other ailments.
      3.Help to ease upset stomach symptoms such as nausea, loating,abdominal pain, and vomiting.
      4.Can be used as a choleretica substance, strengthen liver function byincreasing bile production,also as a centuries-old reputation as a diuretic
      5.Treatment of postmenopausal women with osteoporosis at high risk for fracture
      6.Increase of bone mass in men with primary or hypogonadal osteoporosis at high risk for fracture
      7.Treatment of men and women with osteoporosis associated with sustained systemic glucocorticoid therapy at high risk for fracture



      Company Profile  


    Shop High Quality Factory Supply Low Price Teriparatide Acetate CAS 52232-67-4-Detailed Image 4

    Shaanxi TNJONE Pharmaceutical Co., Ltd is a high-tech enterprise mainly engaged inthe development and sale of pharmaceutical chemical raw materials and relatedproducts.The company has advanced and perfect supporting system,forming advancedchemical synthesis technology, which can quickly meet the individual needs and serialdevelopment from suitable detection to industrial production.Qur business covers morethan 30 countries, most of customers from Europe, Southeast Asia and other countriesin the world, we can guarantee the quality and price. Our enterprise purpose is basedon the market, strengthen strength, take the road of scientific environmental protectionand sustainable development, rely on the country. The company has a strong financialstrength and a good business environment, can provide customers with quality,efficientand fast service.

    Shop High Quality Factory Supply Low Price Teriparatide Acetate CAS 52232-67-4-Detailed Image 5


     Our factory   


    Shop High Quality Factory Supply Low Price Teriparatide Acetate CAS 52232-67-4-Detailed Image 6 Shop High Quality Factory Supply Low Price Teriparatide Acetate CAS 52232-67-4-Detailed Image 7

    Shop High Quality Factory Supply Low Price Teriparatide Acetate CAS 52232-67-4-Detailed Image 8 Shop High Quality Factory Supply Low Price Teriparatide Acetate CAS 52232-67-4-Detailed Image 9

    Shop High Quality Factory Supply Low Price Teriparatide Acetate CAS 52232-67-4-Detailed Image 10

    Shop High Quality Factory Supply Low Price Teriparatide Acetate CAS 52232-67-4-Detailed Image 11 Shop High Quality Factory Supply Low Price Teriparatide Acetate CAS 52232-67-4-Detailed Image 12 Shop High Quality Factory Supply Low Price Teriparatide Acetate CAS 52232-67-4-Detailed Image 13


      How to order  


    Before ordering Please send what items and what quantity you need
    Send quotation We will send you a quotation in detail with total
    Payment ways chosen Please choose one of the payment way you preferred.
    Our payment ways: City bank,BTC,Bank wire, Wise,Master Card , Tether
    After payment Please offer shipping address after payment for shipment.
    Tracking We will provide the tracking after goods sent.
    Lead time About 1-5 working days after payment
    Shipping time About 8-15 days door to door
    After-sale service Available always


    ECHEMI Editorial Reference
    The anabolic drug teriparatide acetate (TA), known as recombinant human parathyroid hormone 1–34, which directly promotes bone formation by generating new osteocytes, has been introduced as a novel therapeutic agent for osteoporosis. Distinct from antiresorptive drug treatment, patients with osteonecrosis of the jaw showed successful clinical outcomes after weekly administration of TA. In addition, adverse outcomes of long-term bisphosphonate treatment, such as bone fracture, were healed after usage of TA, and better bone mass and mineral density improvements at the lumbar spine and femoral neck were achieved with TA treatment than with bisphosphonate treatment[1].
    Teriparatide is a recombinantform of parathyroid hormone, which is used for the treatmentof osteoporosis in men and postmenopausal women.The N-terminal region possesses 34 amino acids, which areidentical to the biologically active region of the 84-aminoacid sequence of human parathyroid hormone. It has beenshown to act on osteoblasts to stimulate new bone growthand improve bone density.
    Parathyroid Hormone Human Synthetic (C181H291N55O51S2) contains 34 amino acids and has a molecular mass of 4117.72 Dalton.The PTH is purified by proprietary chromatographic techniques.

    Basic Info
    Product Name:

    Teriparatide acetate

    Other Name:

    PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF;SER-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE

    CAS No.:

    52232-67-4

    Molecular Formula:

    C172H278N52O47S2

    InChIKeys:

    BUUKFBVDKSFMHN-LKMAISLMSA-N

    Molecular Weight:

    3890.49792

    EC Number:

    640-978-1

    Color/Form:

    White to Off-White

    HScode:

    2937190000

    Categories:

    Other Chemical Drugs

    Characteristics
    Melting Point:

    >205oC (dec.)

    Water Solubility:

    Soluble to 0.40 mg/ml in water

    Critical Temperature & Pressure:

    −20°C

    Hazard Identification

    Classification of the substance or mixture

    Carcinogenicity, Category 2

    Reproductive toxicity, Category 2

    GHS label elements, including precautionary statements

    Pictogram(s)
    Signal word

    Warning

    Hazard statement(s)

    H351 Suspected of causing cancer

    H361 Suspected of damaging fertility or the unborn child

    Precautionary statement(s)
    Prevention

    P203 Obtain, read and follow all safety instructions before use.

    P280 Wear protective gloves/protective clothing/eye protection/face protection/hearing protection/...

    Response

    P318 IF exposed or concerned, get medical advice.

    Storage

    P405 Store locked up.

    Disposal

    P501 Dispose of contents/container to an appropriate treatment and disposal facility in accordance with applicable laws and regulations, and product characteristics at time of disposal.

    Other hazards which do not result in classification

    no data available

    Handling and Storage

    Precautions for safe handling

    Handling in a well ventilated place. Wear suitable protective clothing. Avoid contact with skin and eyes. Avoid formation of dust and aerosols. Use non-sparking tools. Prevent fire caused by electrostatic discharge steam.

    Conditions for safe storage, including any incompatibilities

    Store the container tightly closed in a dry, cool and well-ventilated place. Store apart from foodstuff containers or incompatible materials.

  • Seller Information
    Business Type:

    Manufactory

    Main Products:

    Semaglutide,Tirzepatide,API,Vitamins,Food Additive

    Location:

    No. 4C-11-A392, Financial Port, Northwest corner of Fengjing Avenue and Fengxin Road, Fengdong New City, Xi 'an, Shaanxi Province

    Payment Terms:

    TT against copy of documents,D/P,L/C,D/A,O/A,TT against B/L draft before shipment,100% TT in advance

    Average lead Time:

    5

    Total Annual Revenue:

    $5 million-$10 million

    Total Employees:

    11-50

    Year of Establishment:

    2019

    Shaanxi TNJONE Pharmaceutical Technology Co., LTD., located in the beautiful ancient capital Xi 'an, is committed to the peptide industry, pharmaceutical raw materials, food and feed additives, veterinary drugs and other fields, the enterprise adhering to provide customers with quality service, supply high-quality products, "world peace and health" as its responsibility, the company adhering to the "meet all customer requirements for products" as the service concept, Guarantee "provide qualified products" as the service principle, so that you get "God-like" noble shopping enjoyment. Our company has more than 1000 kinds of polypeptides, raw materials inventory, at any time to meet the various needs of customers for products. Is your best partner.
  • Inquiry History
    10 Inquiries
    Country Product Purchase Quantity Date Posted
    United States

    Teriparatide

    1 KG May 28, 2026
    Russia

    teriparatide

    100 MG Feb 23, 2026
    Kazakstan

    Teriparatide

    1 KG Jan 4, 2026
    Kazakstan

    Teriparatide

    5 MG Jan 1, 2026
    Kazakstan

    teriparatide

    1 KG Nov 17, 2025
    Germany

    Teriparatide Acetate

    5 MG Jul 5, 2026
    United States

    Teriparatide

    10 MT May 29, 2026
    Bulgaria

    teripatatide

    May 17, 2026
    Kazakstan

    Teriparatide

    5 MG Jan 2, 2026
    United Kingdom

    Supply

    Mar 5, 2024
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.