Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > Factory wholesales peptides 154947-66-7 LL37 5mg Peptide with high quatity
Factory wholesales peptides 154947-66-7 LL37 5mg Peptide with high quatity buy - large image1
Factory wholesales peptides 154947-66-7 LL37 5mg Peptide with high quatity buy - image1
Factory wholesales peptides 154947-66-7 LL37 5mg Peptide with high quatity buy - image2
Factory wholesales peptides 154947-66-7 LL37 5mg Peptide with high quatity buy - image3
Factory wholesales peptides 154947-66-7 LL37 5mg Peptide with high quatity buy - image4
Factory wholesales peptides 154947-66-7 LL37 5mg Peptide with high quatity buy - image5
Factory wholesales peptides 154947-66-7 LL37 5mg Peptide with high quatity buy - image6

Factory wholesales peptides 154947-66-7 LL37 5mg Peptide with high quatity

TDS 1 Inquiries

Unit Price: Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

Hongkong,China

Brand:

subi

Packaging:

5mg*l0vials

Price valid (until):

2025-02-28

Company Type:
Trader
Location:
China
Qualification:
Main Products:

peptone

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


     

    Chemical properties:

    TR2 Tirzepatide 2mg*10vials
    TR5 5mg*10vials
    TR10 10mg*10vials
    TR15 15mg*10vials
    TR20 20mg*10vials
    TR30 30mg*10vials
    RT5 Retatrutide 5mg*10vials
    RT10 10mg*10vials
    RT15 15mg*10vials

    Common Name   Tirzepatide
    CAS Number        2023788-19-2
    EINECS No.          200-001-8
    Weight                 4813.45
    Storage                below 25°C

    Items Specifications
    Common Name Tirzepatide
    CAS Number       
     2023788-19-2
    EINECS No.         
     200-001-8

    Shop High Quality Certificated Liraglutide Powder CAS 204656-20-2 Liraglutide-Detailed Image 1 Shop High Quality Certificated Liraglutide Powder CAS 204656-20-2 Liraglutide-Detailed Image 2 Shop High Quality Certificated Liraglutide Powder CAS 204656-20-2 Liraglutide-Detailed Image 3 Shop Factory wholesales peptides 154947-66-7 LL37 5mg Peptide with high quatity-Detailed Image 4 Shop Factory wholesales peptides 154947-66-7 LL37 5mg Peptide with high quatity-Detailed Image 5
    Shop Factory wholesales peptides 154947-66-7 LL37 5mg Peptide with high quatity-Detailed Image 6

    Peptide Storage Guidelines: General Tips

    When storing peptides, remember to:

    • Store peptide in a cold, dry, dark place
    • Avoid repeated freezing and thawing of peptide
    • Avoid overexposure to the air
    • Avoid light exposure
    • Avoid storing peptides in solution long term
    • Aliquot peptide according to experimental requirements


    Hazard Identification

    Classification of the substance or mixture

    Acute toxicity - Category 4, Oral

    Reproductive toxicity, Category 1A

    Hazardous to the aquatic environment, long-term (Chronic) - Category Chronic 4

    GHS label elements, including precautionary statements

    Pictogram(s) Shop Best price best quality Kisspeptin-10 in stock door-to-door-Detailed Image 8
    Signal word

    Danger

    Hazard statement(s)

    H302 Harmful if swallowed

    H360 May damage fertility or the unborn child

    H413 May cause long lasting harmful effects to aquatic life

    Precautionary statement(s)
    Prevention

    P264 Wash ... thoroughly after handling.

    P270 Do not eat, drink or smoke when using this product.

    P203 Obtain, read and follow all safety instructions before use.

    P280 Wear protective gloves/protective clothing/eye protection/face protection/hearing protection/...

    P273 Avoid release to the environment.

    Response

    P301+P317 IF SWALLOWED: Get medical help.

    P330 Rinse mouth.

    P318 IF exposed or concerned, get medical advice.

    Storage

    P405 Store locked up.

    Disposal

    P501 Dispose of contents/container to an appropriate treatment and disposal facility in accordance with applicable laws and regulations, and product characteristics at time of disposal.

    Other hazards which do not result in classification

    no data available


    Handling and Storage

    Precautions for safe handling

    Handling in a well ventilated place. Wear suitable protective clothing. Avoid contact with skin and eyes. Avoid formation of dust and aerosols. Use non-sparking tools. Prevent fire caused by electrostatic discharge steam.

    Conditions for safe storage, including any incompatibilities

    Store the container tightly closed in a dry, cool and well-ventilated place. Store apart from foodstuff containers or incompatible materials.

    Packing and shipping:

    Shop Semax Acetate factory direct white raw powder with high quality-Detailed Image 6

     

    Shop Semax Acetate factory direct white raw powder with high quality-Detailed Image 7

    Why choose us  

    1. All peptides and raws purity >=99% purity

    Many HPLC test reports are available (Janoshik).
    2. 100% Safe delivery
    3. Oversea warehouses and stocks: USA, Canada, Europe and Australia.
    4. Cheapest prices in the market, unbeatable!
    5. Payment options: Credit card, bank transfer, wise, alipay, apple pay, google pay, wechat, bitcoin,usdt,Remitly,Money gram



      Company Profile  

    Shop Linaelotide Acetate high quality white raw powder factory direct 5mg 851199-59-2-Detailed Image 8 Shop Linaelotide Acetate high quality white raw powder factory direct 5mg 851199-59-2-Detailed Image 9

    FAQ 


    Q1: May I get one sample before placing order?

    Re: Yes, Sample are available. For normal products, samples are for free and you just need to bear the freight; For those high value products, you just need to freight and certain product cost. When we both cooperate for some times or when you are our VIP customer, free sample will be offered when you need.

    Q2: Which payment is available for your company?

    Re: Credit card, bank transfer, wise, alipay, apple pay, google pay, wechat, bitcoin,usdt,Remitly,Money gram etc. You can choose the one which is convenient for you.

    Q3: How and when can I get my goods after payment?

    Re: For small quantity products, they will be delivered to you by international courier(DHL, FedEx, TNT etc.) or by air. Usually it will cost 5-7days that you can get the goods after delivery.For large quantity products, shipping by see is worthwhile.It will cost 15 to 30 days to come to your destination port, which depends on where the port is.

    Q4: Is there any possible to use my appointed label or package?

    Re: Yes. If needed, we'd like to.


    RFQ  


    1. How to make payment?   
    We accept  Alibaba trade assurance; Delivery after payment only.   
    2. How and when to deliver goods? 
    We delivery goods by Express, USA & EU special line/Royal Mail/UPS/USPS/DHL/Fedex/EMS/E packet.
    By sea or by air are also used.  

    3. How to distinguish product quality? 
    You get what you paid for, we can't be the cheapest but product must be safe and good.   
    We can provide COA and HPLC test reports for your reference,  and COA for the acutal lot before delivery for your evaluation.  We always recommend testing quality first with trail order.  

    4. what can you buy from us?

    hemical products、Industrial textile products、Plastic products、Rubber products、cosmetics、mechanical equipment、Hardware products. 

    5. why should you buy from us not from other suppliers?

    Before-sale service, after sale technical consultancy service.

     6. How to place order online?

    Performa invoice will be sent after confirmation from the client along with our bank details. In the same time we also accept PO as an confirmation to prepare the shipment.


    Certificates

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    peptone

    Location:

    Room A109, No. 29 Dongting Road, Hexi District, Tianjin

    Payment Terms:

    TT against copy of documents

    Average lead Time:

    3

    Total Annual Revenue:

    $2.5 million-$5 million

    Total Employees:

    Less than 5

    Year of Establishment:

    2024

  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.