Product
Supplier
Encyclopedia
Inquiry
Home > Biochemical Engineering > Polypeptide > LL-37 for Sale > 99% Purity LL37 Lyophilized Cosmetic Peptide Powder, 5mg 10mg Vials, US Local Warehouse
99% Purity LL37 Lyophilized Cosmetic Peptide Powder, 5mg 10mg Vials, US Local Warehouse buy - large image1
99% Purity LL37 Lyophilized Cosmetic Peptide Powder, 5mg 10mg Vials, US Local Warehouse buy - image1
99% Purity LL37 Lyophilized Cosmetic Peptide Powder, 5mg 10mg Vials, US Local Warehouse buy - image2
99% Purity LL37 Lyophilized Cosmetic Peptide Powder, 5mg 10mg Vials, US Local Warehouse buy - image3
99% Purity LL37 Lyophilized Cosmetic Peptide Powder, 5mg 10mg Vials, US Local Warehouse buy - image4
99% Purity LL37 Lyophilized Cosmetic Peptide Powder, 5mg 10mg Vials, US Local Warehouse buy - image5
99% Purity LL37 Lyophilized Cosmetic Peptide Powder, 5mg 10mg Vials, US Local Warehouse buy - image6

99% Purity LL37 Lyophilized Cosmetic Peptide Powder, 5mg 10mg Vials, US Local Warehouse

TDS 3 Inquiries

Unit Price: Get Latest Price
CAS No.:

154947-66-7

Grade:

Research Grade

Content:

99%

Port:

guangzhou

Brand:

HF

Packaging:

5mg/vial

Price valid (until):

2026-08-02

Company Type:
Trader
Location:
China
Qualification:
Main Products:

peptides

  • Product Description

  • Seller Information

  • Inquiry History

  • Description

    WhatsAPP:+85255073603
    +8619933204008
    Email:sales01@yw-jl.cn


    Basic Information


    Shop Best price  Oxytocin Acetate vials Pure Oxytocin raw powder CAS 50-56-6-Detailed Image 1 Shop Best price  Oxytocin Acetate vials Pure Oxytocin raw powder CAS 50-56-6-Detailed Image 2

        1. Product Name: LL-37 Peptide (Cathelicidin Antimicrobial Peptide)
        2. CAS No.: 154947-66-7
        3. Molecular Weight: 4493.0 g/mol
        4. Amino Acid Length: 37 amino acid cationic antimicrobial peptide
        5. Purity: ≥99% HPLC High Purity, single maximum impurity ≤0.3%
        6. Appearance: White sterile lyophilized fine powder, uniform loose texture
        7. Grade: Premium Cosmetic Grade & Research Grade, low endotoxin, high biological activity
        8. Available Specifications: 5mg/vial, 10mg/vial, bulk powder customizable
        9. Packaging: Sterile glass vial with rubber stopper & aluminum crimp cap
        10. Solubility: Soluble in sterile water or mild acidic solution, forms clear solution after gentle mixing
        11. Mechanism of Action: Host defense peptide, broad-spectrum antimicrobial, anti-inflammatory & tissue repair
        12. Warehouse Location: US local warehouse stocked
        13. Logistics Advantage: Fast US domestic delivery, safe global shipping, short transit time
        14. Storage Condition: Sealed storage at -20℃, light-proof & moisture-proof, avoid repeated freeze-thaw cycles
        15. Support Documents: Complete COA, HPLC, Mass Spectrum, heavy metal and microbial test reports

    Category Peptides CAS 154947-66-7
    Bottle Color Transparent Model 375
    Purity 99% Storage Dry Cool Sealed Container
    Specification

    5mg

    Form Lyophilized Powder(Freeze-Dried Powder)

    Shop Top Quality Peptides Lyophilized Powder Tirzepatide Fitness and  Weight Loss-Detailed Image 3 Shop Top Quality Peptides Lyophilized Powder Tirzepatide Fitness and  Weight Loss-Detailed Image 4


    Product Description


      1. LL-37 CAS 154947-66-7 is a multifunctional host defense peptide with 99% HPLC high purity, supplied as 5mg and 10mg sterile lyophilized vials. As a premium cosmetic peptide, all goods are stocked in US local warehouse to support fast domestic US delivery and efficient global safe shipping.
        As a natural cationic antimicrobial peptide from the cathelicidin family, LL-37 delivers multiple skincare benefits. It provides broad-spectrum antimicrobial activity against acne-causing bacteria like P. acnes and S. aureus, effectively improving inflammatory acne and redness without inducing drug resistance. It also exerts potent anti-inflammatory effects by inhibiting pro-inflammatory cytokine release, relieving skin redness, irritation and sensitivity. Furthermore, it promotes keratinocyte proliferation and migration, accelerates skin barrier repair and wound healing, improves acne scars and damaged skin, and stimulates collagen synthesis for anti-aging benefits. Mild and non-irritating, it is perfectly suitable for acne treatment, sensitive skin soothing, barrier repair and post-procedure skincare formulas.
        With US local warehouse stock, delivery time for North America is greatly shortened with smooth customs clearance. The fine powder has good solubility and excellent formulation compatibility, suitable for serums, essences, creams and masks. We are direct manufacturer with competitive wholesale price and sufficient ready stock. Small sample trials and large bulk long-term cooperation are both available with customizable packaging. Every batch passes full-range quality inspection with complete COA, HPLC and MS test reports, fully compliant with international cosmetic peptide export standards.

        Shop Top Quality Peptides Lyophilized Powder Tirzepatide Fitness and  Weight Loss-Detailed Image 5 Shop Top Quality Peptides Lyophilized Powder Tirzepatide Fitness and  Weight Loss-Detailed Image 6


    Payment Method 


    Shop Top Quality Peptides Lyophilized Powder Tirzepatide Fitness and  Weight Loss-Detailed Image 7


       Packaging and Delivery  


    Shop Top Quality Peptides Lyophilized Powder Tirzepatide Fitness and  Weight Loss-Detailed Image 8 Shop Top Quality Peptides Lyophilized Powder Tirzepatide Fitness and  Weight Loss-Detailed Image 9


    Q&A  


    Q1: Are you a supplier or a manufacturer?
    A: We are both a supplier and a manufacturer.
    Q2: How do you make the delivery?
    A: We have established stable cooperative relationships with DHL, TNT, UPS, FedEx, EMS, China Post Air Express, etc. For container transportation, we can arrange for sea shipping; you can also choose your own freight forwarder.
    Q3: What payment methods do you accept?
    A: We accept Bitcoin and USDT.
    Q4: How about the after-sales service?
    A: We offer high-quality products and guarantee 100% safe delivery.
    Q5: How do you ensure product quality?
    A: We will send you the analysis report (COA) of the sample to confirm the quality.
    Q6: How can we verify the quality of the products before placing an order?
    A: For some products, free samples are available. You only need to bear the shipping cost or arrange for a courier to pick them up. You can also provide the product specifications and requirements, and we will produce them accordingly.
    Q7: Are there any discount offers?
    A: Yes, the larger the order quantity, the more favorable the price will be .


      Company Profile


    Company Profile: Tianjin Huifeng Technology Co., Ltd. is a company specializing in the production of various peptide products and chemical raw materials. We have a professional R&D team and an efficient and reliable logistics team to ensure that you can receive high-quality products safely and on time. Our customers are located in the United States, Europe, Japan, South Korea, India, and other regions. Most of our main products are in stock and can be shipped immediately. Please inform us of your specific quantity requirements, and we will provide you with the most competitive prices. Welcome to contact us at any time for more information.
    We offer a wide range of peptide products, which are widely used in life science research, drug development, cosmetics, anti-aging medicine, and functional health supplements. We guarantee excellent product quality and competitive prices. Customers who have ordered our peptide products have always given high evaluations. We sincerely welcome reliable buyers from all over the world to contact us and negotiate business cooperation for peptide products. 

    Shop Top Quality Peptides Lyophilized Powder Tirzepatide Fitness and  Weight Loss-Detailed Image 10 Shop Top Quality Peptides Lyophilized Powder Tirzepatide Fitness and  Weight Loss-Detailed Image 11 Shop Top Quality Peptides Lyophilized Powder Tirzepatide Fitness and  Weight Loss-Detailed Image 12

    ECHEMI Editorial Reference
    LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.
    Research & Reference Note

    99% Purity LL37 Lyophilized Cosmetic Peptide Powder, 5mg 10mg Vials, US Local Warehouse is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals

    Certificates

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Polypeptide

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    peptides

    Location:

    No. 85, Qingnian Road, Hongqiao District, Tianjin

    Total Annual Revenue:

    $5 million-$10 million

    Total Employees:

    51-100

    Year of Establishment:

    2026

  • Inquiry History
    3 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.