Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > LL37 purity 99% freeze dried powder cas154947-66-7 antibacterial peptide
LL37 purity 99% freeze dried powder cas154947-66-7 antibacterial peptide buy - large image1
LL37 purity 99% freeze dried powder cas154947-66-7 antibacterial peptide buy - image1
LL37 purity 99% freeze dried powder cas154947-66-7 antibacterial peptide buy - image2
LL37 purity 99% freeze dried powder cas154947-66-7 antibacterial peptide buy - image3
LL37 purity 99% freeze dried powder cas154947-66-7 antibacterial peptide buy - image4
LL37 purity 99% freeze dried powder cas154947-66-7 antibacterial peptide buy - image5
LL37 purity 99% freeze dried powder cas154947-66-7 antibacterial peptide buy - image6

LL37 purity 99% freeze dried powder cas154947-66-7 antibacterial peptide

GMP HALAL KOSHER ISO FDA 3 Inquiries

Unit Price: Get Latest Price
CAS No.:

154947-66-7

Grade:

Chemical Grade

Content:

99%

Port:

qingdao

Brand:

First Chems Co., LTD

Packaging:

10mg 15mg/vial 10vials/box

Price valid (until):

2025-04-19

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Titanium dioxide,npk,pvc,sles,labsa,mdi

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail   


    Description


     

      Product Detail  

     


    Sales manager:Jenny
    whatsapp:+8617331136691
    Email:17331136691@163.com

    • LL-37:  functions as an antiviral and antibacterial peptide by inhibiting early steps in the viral replication cycle and perforating cytoplasmic bacterial membranes (25–27). In addition to penetrating bacterial membranes, LL-37 prevents biofilm formation and enhances bacterial phagocytosis
    • The importance of peptides:
    • Many active substances in the human body are in the form of peptides. Peptides are involved in various fields of human hormones, nerves, cell growth and reproduction, and their importance is to regulate the physiological functions of various systems and cells in the body, activate the relevant enzyme systems in the body, promote the permeability of intermediate metabolic membranes, or control DNA transcription or affect specific protein synthesis, and ultimately produce specific physiological effects. Peptides are important substances involved in various cell functions in human body. Peptides can be synthesized into cells and regulate their functional activities. Peptides act as neurotransmitters in the body, transmitting information. Peptides can be used as transportation tools in the human body to transport various nutrients and various vitamins, biotin, calcium and trace elements beneficial to the human body to the cells, organs and tissues of the human body. Peptide is an important physiological regulator of the human body, which can comprehensively regulate the physiological function of the human body, enhance and exert the physiological activity of the human body, and it has important biological functions.

    Items Specifications

    Product Name   

     LL-37

    CAS 

    154947-66-7
    Molecular Formula C205H340N60O53
    color White
    Form Solid freeze-dried powder
    Storage condition  -20°C
    Purity     99%  
     Packaging Bottle, Can, Drum, Plastic Container, Vacuum Packet (According to customers' requirements)  
     Trademark Customzied accepted   

    Shop Growth Hormone-Inhibiting Hormone CAS 51110-01-1 Somatostatin with wholesale price-Detailed Image 1 Shop Growth Hormone-Inhibiting Hormone CAS 51110-01-1 Somatostatin with wholesale price-Detailed Image 2 Shop Growth Hormone-Inhibiting Hormone CAS 51110-01-1 Somatostatin with wholesale price-Detailed Image 3 Shop Growth Hormone-Inhibiting Hormone CAS 51110-01-1 Somatostatin with wholesale price-Detailed Image 4 Shop Growth Hormone-Inhibiting Hormone CAS 51110-01-1 Somatostatin with wholesale price-Detailed Image 5 Shop Growth Hormone-Inhibiting Hormone CAS 51110-01-1 Somatostatin with wholesale price-Detailed Image 6 Shop Growth Hormone-Inhibiting Hormone CAS 51110-01-1 Somatostatin with wholesale price-Detailed Image 7 Shop Growth Hormone-Inhibiting Hormone CAS 51110-01-1 Somatostatin with wholesale price-Detailed Image 8





    Company profile

    Shop Household Sodium Percarbonate Factory direct sales-Detailed Image 2

    First Chems Co., LTD is an enterprise mainly in engaged in researching, producing and saling new-born API. Our company is located in Shijiazhuang city,Hebei province.
    We have many years of professional experiences and a professional team of scientists and advanced equipments. Nowadays we formed a large varieties large scale, complete categories and high technology content product chain. Our quality system has been accredited by SGS and our quality center guarantees quality with full documentation control and complete facilities.
    Based on the good quality, pretty competitive price and safe delivery our products are widely exported to many different countries, like Netherlands, Spain, UK, USA and so on. And our products are highly recognized by customers around the world, so we can build long-term cooperative relationship with many pharmaceutical enterprises in the world. We upload the principles of openness and transparency and dedicated to provide efficient and high quality services to every customer. We are sincerely looking forward to establishing a long-term stable and win-win business relationship with every customer.


    Packing and Shipping

    Shop Household Sodium Percarbonate Factory direct sales-Detailed Image 3 Shop Household Sodium Percarbonate Factory direct sales-Detailed Image 4

    Our Advandage

    1.High quality --Coming from good materials and high technology.                  
    2.Lower price--Not cheapest but the lowest at the same quality.                  
    3.Good service--Satisfactory service before and after sale.4.We have our own warehouses in Australia, the United States, Germany, Canada and other countries, which greatly saves shipping time and customers can receive their packages faster. In addition, customers can also choose door-to-door pickup service.

    FAQ
    Q: How to order this product?
    A: You can click "contact now" , and send us a inquiry, leave your number if possible, we will contact with you as soon as possible, then we can talk order details.
    Q: How long can I receive my ordered goods?
    A: We ship by express door to door; you can receive it in 7-10 days.
    Q: What liquid should I add into the vial? And how much liquid needed?
    A: You can add sterile water or saline, 1 vial add 1ml liquid is ok.
    Q: Will I have any side effects after using peptide?
    A: If you just begin to use, it is better to follow doctor's prescription. And if there is no allergy or any uncomfortable symptom, you can continue to use but take it in a suitable dosage. A few people will have slight allergy reaction, but after your body get used to it, the allergy will be disappear and back to normal.
    Q: How to store it?
    A: If it hasn't been opened, just put it in cool dry place, if it is opened, you may put it in cold storage for 2-5 degree condition.
    ECHEMI Editorial Reference
    LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.
    Research & Reference Note

    LL37 purity 99% freeze dried powder cas154947-66-7 antibacterial peptide is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals

    Certificates

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Titanium dioxide,npk,pvc,sles,labsa,mdi

    Location:

    37 Keji Road, Yanta District, Xi 'an City, Shaanxi Province

    Payment Terms:

    TT against copy of documents,L/C,TT against B/L draft before shipment,100% TT in advance

    Average lead Time:

    15

    Total Annual Revenue:

    $5 million-$10 million

    Total Employees:

    Less than 5

    Year of Establishment:

    2020

    COMPANY OVERVIEW

    First Chems Co., LTD,a joint-stock enterprise with production, export and services of chemicals, has widely adopted world-advanced equipments and management system, and our products quality is assured under the ISO9001 and ISO14001 standards, mainly specializes in developing Agriculture/Fertilizer chemicals series, Washing detergent chemicals series, Soda alkali chemicals series, Water treatment chemical series, etc.

    Our main products include:

    a. Agriculture/Feed chemicals series : Zinc Sulphate, Manganese sulfate etc.), 

    b. Washing detergent chemicals series : (LABSA, SLES, CEDA,STPP, etc.)

    c.  Soda alkali chemicals series : ( Caustic Soda , Sodium Sulphate Anhydrous etc.) 

    d. Water treatment chemical series: (Calcium hypochlorite, TCCA,SDIC, PAC- poly aluminium chloride, PFS, Aluminium sulfate etc.) 

    e. Adsorbent Desiccant Activated Alumina Ball

    f.  Raw material Calcium Aluminate ,Aluminium Hydroxide

  • Inquiry History
    3 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.