 Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > LL37 purity 99% freeze dried powder cas154947-66-7 antibacterial peptide

LL37 purity 99% freeze dried powder cas154947-66-7 antibacterial peptide buy - large image1

LL37 purity 99% freeze dried powder cas154947-66-7 antibacterial peptide buy - image1

LL37 purity 99% freeze dried powder cas154947-66-7 antibacterial peptide buy - image2

LL37 purity 99% freeze dried powder cas154947-66-7 antibacterial peptide buy - image3

LL37 purity 99% freeze dried powder cas154947-66-7 antibacterial peptide buy - image4

LL37 purity 99% freeze dried powder cas154947-66-7 antibacterial peptide

Name: LL37 purity 99% freeze dried powder cas154947-66-7 antibacterial peptide
Brand: First Chems Co., LTD
SKU: pr2503191610
Price: 25 USD
Availability: InStock

GMP HALAL KOSHER ISO FDA

Unit Price: Get Latest Price 

CAS No.:

154947-66-7

Grade:

Chemical Grade

Content:

99%

Port:

qingdao

Brand:

First Chems Co., LTD

Packaging:

10mg 15mg/vial 10vials/box

Price valid (until):

2025-04-19

Contact Supplier

 Chat Now

First Chems Co., LTD

Company Type:

Trader

Location:

China

Qualification:

Main Products:

Titanium dioxide,npk,pvc,sles,labsa,mdi

 Visit Store

Product Description
Seller Information

Description

Product Detail

Description

Product Detail

Sales manager:Jenny
whatsapp：+8617331136691
Email:17331136691@163.com

LL-37： functions as an antiviral and antibacterial peptide by inhibiting early steps in the viral replication cycle and perforating cytoplasmic bacterial membranes (25–27). In addition to penetrating bacterial membranes, LL-37 prevents biofilm formation and enhances bacterial phagocytosis
The importance of peptides:
Many active substances in the human body are in the form of peptides. Peptides are involved in various fields of human hormones, nerves, cell growth and reproduction, and their importance is to regulate the physiological functions of various systems and cells in the body, activate the relevant enzyme systems in the body, promote the permeability of intermediate metabolic membranes, or control DNA transcription or affect specific protein synthesis, and ultimately produce specific physiological effects. Peptides are important substances involved in various cell functions in human body. Peptides can be synthesized into cells and regulate their functional activities. Peptides act as neurotransmitters in the body, transmitting information. Peptides can be used as transportation tools in the human body to transport various nutrients and various vitamins, biotin, calcium and trace elements beneficial to the human body to the cells, organs and tissues of the human body. Peptide is an important physiological regulator of the human body, which can comprehensively regulate the physiological function of the human body, enhance and exert the physiological activity of the human body, and it has important biological functions.

Items	Specifications
Product Name	LL-37
CAS	154947-66-7
Molecular Formula	C205H340N60O53
color	White
Form	Solid freeze-dried powder
Storage condition	-20°C
Purity	99%
Packaging	Bottle, Can, Drum, Plastic Container, Vacuum Packet (According to customers' requirements)
Trademark	Customzied accepted

Shop Growth Hormone-Inhibiting Hormone CAS 51110-01-1 Somatostatin with wholesale price-Detailed Image 1

Company profile

First Chems Co., LTD is an enterprise mainly in engaged in researching, producing and saling new-born API. Our company is located in Shijiazhuang city,Hebei province.
We have many years of professional experiences and a professional team of scientists and advanced equipments. Nowadays we formed a large varieties large scale, complete categories and high technology content product chain. Our quality system has been accredited by SGS and our quality center guarantees quality with full documentation control and complete facilities.
Based on the good quality, pretty competitive price and safe delivery our products are widely exported to many different countries, like Netherlands, Spain, UK, USA and so on. And our products are highly recognized by customers around the world, so we can build long-term cooperative relationship with many pharmaceutical enterprises in the world. We upload the principles of openness and transparency and dedicated to provide efficient and high quality services to every customer. We are sincerely looking forward to establishing a long-term stable and win-win business relationship with every customer.

Packing and Shipping

Our Advandage

1.High quality --Coming from good materials and high technology.
2.Lower price--Not cheapest but the lowest at the same quality.
3.Good service--Satisfactory service before and after sale.4.We have our own warehouses in Australia, the United States, Germany, Canada and other countries, which greatly saves shipping time and customers can receive their packages faster. In addition, customers can also choose door-to-door pickup service.

FAQ

Q: How to order this product?
A: You can click "contact now" , and send us a inquiry, leave your number if possible, we will contact with you as soon as possible, then we can talk order details.
Q: How long can I receive my ordered goods?
A: We ship by express door to door; you can receive it in 7-10 days.
Q: What liquid should I add into the vial? And how much liquid needed?
A: You can add sterile water or saline, 1 vial add 1ml liquid is ok.
Q: Will I have any side effects after using peptide?
A: If you just begin to use, it is better to follow doctor's prescription. And if there is no allergy or any uncomfortable symptom, you can continue to use but take it in a suitable dosage. A few people will have slight allergy reaction, but after your body get used to it, the allergy will be disappear and back to normal.
Q: How to store it?
A: If it hasn't been opened, just put it in cool dry place, if it is opened, you may put it in cold storage for 2-5 degree condition.

Certificates

Basic Info

Product Name:

LL-37

Other Name:

Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

CAS No.:

154947-66-7

Molecular Formula:

C205H340N60O53

InChIKeys:

POIUWJQBRNEFGX-XAMSXPGMSA-N

Molecular Weight:

EC Number:

211-519-9

Color/Form:

White to off-white

Categories:

Bulk Drug Intermediates

Characteristics

Water Solubility:

Soluble to 1 mg/ml in water

Seller Information

Business Type:
Trader

Main Products:
Titanium dioxide,npk,pvc,sles,labsa,mdi

Location:
37 Keji Road, Yanta District, Xi 'an City, Shaanxi Province

Payment Terms:
TT against copy of documents,L/C,TT against B/L draft before shipment,100% TT in advance

Average lead Time:
15

Total Annual Revenue:
$5 million-$10 million

Total Employees:
Less than 5

Year of Establishment:
2020

COMPANY OVERVIEW

First Chems Co., LTD，a joint-stock enterprise with production, export and services of chemicals, has widely adopted world-advanced equipments and management system, and our products quality is assured under the ISO9001 and ISO14001 standards, mainly specializes in developing Agriculture/Fertilizer chemicals series, Washing detergent chemicals series, Soda alkali chemicals series, Water treatment chemical series, etc.

Our main products include:

a. Agriculture/Feed chemicals series : Zinc Sulphate, Manganese sulfate etc.),

b. Washing detergent chemicals series : (LABSA, SLES, CEDA,STPP, etc.)

c. Soda alkali chemicals series : ( Caustic Soda , Sodium Sulphate Anhydrous etc.)

d. Water treatment chemical series: (Calcium hypochlorite, TCCA,SDIC, PAC- poly aluminium chloride, PFS, Aluminium sulfate etc.)

e. Adsorbent Desiccant Activated Alumina Ball

f. Raw material Calcium Aluminate ,Aluminium Hydroxide
Country Product Purchase Quantity Date Posted

Post an enquiry for this product

More Choices Find All Products for Sale 

Product Name	Grade / Content	Price	Supplier Name	Details
Tirzepatide 2mg/3ml sm ms ds ghk nad Antioxidant Detoxification Skin Whitening Brightening Anti-aging	Pharmaceutical Grade/99	$11-14/UNIT FOB	Guangzhou Duo Run Trading	Inquiry
Lemon Bottle LC120 LC216 LC526 LC600 CBL60 5AD SMO5 SMO10 KS5 KS10 BB10 BB20 KPV5 KPV10 AK100 VIP5 VIP10	Pharmaceutical Grade/99	$1/G FOB	Hong Kong Chengtai Co., Ltd.	Inquiry
High Purity & Quality LL37 with Fast and Safe shipping CAS 154947-66-7	Pharmaceutical Grade/99	$85/UNIT FOB	Shengyufan International Trading Co., Ltd.	Inquiry
Peptide White Powder LL-37 99% Purity LL37 Antimicrobial Peptide CAS:154947-66-7	Pharmaceutical Grade/99	$100-130/UNIT FOB		Inquiry
Antibacterial Protein LL-37 (human)	Research and Industrial Grade/98.00		Hangzhou Go Top Peptide Biotech Co.,Ltd.	Inquiry

LL37 purity 99% freeze dried powder cas154947-66-7 antibacterial peptide

Product Description

Seller Information

More Choices Find All Products for Sale 

Related Searches