Product
Supplier
Encyclopedia
Inquiry
Home > Catalyst and Auxiliary > UV Absorbers > LL-37 for Sale > High quality wholesales peptides 154947-66-7 LL37 Peptide with high quatity
High quality  wholesales peptides 154947-66-7 LL37  Peptide with high quatity buy - large image1
High quality  wholesales peptides 154947-66-7 LL37  Peptide with high quatity buy - image1
High quality  wholesales peptides 154947-66-7 LL37  Peptide with high quatity buy - image2
High quality  wholesales peptides 154947-66-7 LL37  Peptide with high quatity buy - image3
High quality  wholesales peptides 154947-66-7 LL37  Peptide with high quatity buy - image4
High quality  wholesales peptides 154947-66-7 LL37  Peptide with high quatity buy - image5
High quality  wholesales peptides 154947-66-7 LL37  Peptide with high quatity buy - image6

High quality wholesales peptides 154947-66-7 LL37 Peptide with high quatity

3 Inquiries

Unit Price: Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

shanghai

Brand:

QYC

Packaging:

10vials/box

Price valid (until):

2025-06-08

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Cosmetic raw material

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product description


    Name: sunny
    WhatsApp: +8615503672829

        • Ll-37, Human is an amphiphilic cathepsin derived antimicrobial peptide with 37 residues and has a wide range of antibacterial activities. Ll-37, Human helps protect the cornea from infection and regulate wound healing.

      Our products enjoy good reputation both at home and abroad. Our trade partners are around the world, mainly in America,Europe,Australia,South East Asia ,Middle East and South Africa. In order to serve customers well, the company has established special technical department and after-sale service department. We will make careful reply if you get any question.

      The company with all the employees will constantly purse excellent quality, perfect brand and our image, and adheres to our spirit of honesty, diligence, seeking truth and progress and insists on business philosophy of quality as life and service as soul. We will satisfy market demands by top products and better service, and will welcome market challenge forever.



    Shop Safe delivery Wholesale Price PEG MGF CAS 108174-48-7 Customized Peptides 2mg-Detailed Image 1


      Product details



    Items Specifications
    Product Name  LL37
    CAS 154947-66-7 
    Appearance White freeze-dried powder
    Purity 99

    Appearance: Powder

    Purity: >99%
    Shipping Condition: Shipped under ambient temperature as non-hazardous chemical. This product is stable enough for a few weeks during ordinary shipping and time spent in Customs.

    Storage Condition: Dry, dark and at 0 - 4 C for short term (days to weeks) or -20 C for long term (months to years).

    Shelf Life: >2 years if stored properly


      product display


    Shop High Purity Mots-C 10mg 40mg Peptide Lyophilized Mots-C for Lose Weight  CAS 1627580-64-6-Detailed Image 2 Shop Surprise price Epitalon CAS 307297-39-8  peptide Epithalone Powder Export places-Detailed Image 3  Shop High Purity Mots-C 10mg 40mg Peptide Lyophilized Mots-C for Lose Weight  CAS 1627580-64-6-Detailed Image 4     


      Express and packaging


    Shop High Purity Mots-C 10mg 40mg Peptide Lyophilized Mots-C for Lose Weight  CAS 1627580-64-6-Detailed Image 5

    10vials/box 

    Peptide Storage Guidelines: 

    • Store peptide in a cold, dry, dark place
    • Avoid repeated freezing and thawing of peptide
    • Avoid overexposure to the air
    • Avoid light exposure
    • Avoid storing peptides in solution long term



    Shop High Purity Mots-C 10mg 40mg Peptide Lyophilized Mots-C for Lose Weight  CAS 1627580-64-6-Detailed Image 6


      Company profile


    Shanxi Qianyecao Biotechnology Co., Ltd. is a newly established biotechnology company, focusing on the research and development and production of chemical products, and is committed to exporting high-quality products to the world. The company takes science and technology as the guide, adheres to the spirit of innovation, and provides customers with efficient, safe and reliable chemical product solutions. As a rising star in the chemical industry, Shanxi Qianyecao Biotechnology Co., Ltd. has a high-quality, professional R & D team. Team members have deep academic background and rich practical experience in the field of chemical product research and development. We constantly track the industry's cutting-edge technology and develop a series of competitive chemical products according to market demand. In terms of product quality control, Shanxi Chibacao Biotechnology Co., Ltd. adheres to the strict quality management system. From raw material procurement to production process to product testing, every link is strictly checked to ensure high quality and stability of products. The introduction of advanced production equipment and testing instruments to ensure that each batch of products meet international standards and customer requirements. As a biotechnology company facing the global market, the products of Shanxi Qianyecao Biotechnology Co., Ltd. are exported to many countries and regions, and have won widespread praise and trust from customers. We always adhere to the principle of "quality first, customer first", customer-oriented, providing personalized product customization and solutions to meet the diverse needs of different customers. Looking to the future, Shanxi Qianyecao Biotechnology Co., Ltd. will continue to increase investment in research and development, and constantly expand new application fields and market space. Driven by technological innovation and guided by market demand, we will continuously improve product quality and service level, and strive to become a global leader in the field of chemical

    Shop High Purity Mots-C 10mg 40mg Peptide Lyophilized Mots-C for Lose Weight  CAS 1627580-64-6-Detailed Image 7
    Shop High Purity Mots-C 10mg 40mg Peptide Lyophilized Mots-C for Lose Weight  CAS 1627580-64-6-Detailed Image 8


    Advantage


    Shop High Purity Mots-C 10mg 40mg Peptide Lyophilized Mots-C for Lose Weight  CAS 1627580-64-6-Detailed Image 9 Shop High Purity Mots-C 10mg 40mg Peptide Lyophilized Mots-C for Lose Weight  CAS 1627580-64-6-Detailed Image 10


      exhibition


    Shop High Purity Mots-C 10mg 40mg Peptide Lyophilized Mots-C for Lose Weight  CAS 1627580-64-6-Detailed Image 11


    FAQ  


    1. How to place an order?
    Send me a message, let me know the product you need, specifications and quantity, and then I will calculate it for you

    2. What about the delivery time and transportation mode?
    After receiving your payment, we will send the parcel to you via USPS, FEDEX, DHL Parcel and YANWEN Express. After updating the logistics, it will take about 7-15 days to arrive at your address.

    3. How do I save the peptide when I receive it?
    Polypeptides in the form of freeze-dried powder can be transported in vacuum packaging at room temperature, while polypeptides in the dissolved state need to be refrigerated at 2 ° C - 8 ° C. For long-term storage, the peptide should be stored in the form of freeze-dried powder at -20 ° C or -80 ° C in a sealed container with a desiccant, which can minimize the degradation of the peptide.

    4. What are the terms of payment?
    We support paypal, Bitcoin, USDT payments.



    ECHEMI Editorial Reference
    LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.
    Research & Reference Note

    High quality wholesales peptides 154947-66-7 LL37 Peptide with high quatity is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    UV Absorbers

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Cosmetic raw material

    Location:

    21st floor, Building 4, Zhonghai World, No. 8, Section 1, Jinci Road, Xiyuan Street, Wanbolin District, Taiyuan City, Shanxi Province

    Payment Terms:

    100% TT in advance

    Average lead Time:

    7

    Total Annual Revenue:

    $5 million-$10 million

    Total Employees:

    11-50

    Year of Establishment:

    2024

    Certifications:

    Janoshik Tirz,Janoshik Reta,Janoshik Sema

    Company Profile
    Shanxi Qianyecao Biotechnology Co., Ltd. is a newly established biotechnology company, focusing on the research and development and production of chemical products, and is committed to exporting high-quality products to the world. The company takes science and technology as the guide, adheres to the spirit of innovation, and provides customers with efficient, safe and reliable chemical product solutions. As a rising star in the chemical industry, Shanxi Qianyecao Biotechnology Co., Ltd. has a high-quality, professional R & D team. Team members have deep academic background and rich practical experience in the field of chemical product research and development. We constantly track the industry's cutting-edge technology and develop a series of competitive chemical products according to market demand. In terms of product quality control, Shanxi Qianyecao Biotechnology Co., Ltd. adheres to the strict quality management system. From raw material procurement to production process to product testing, every link is strictly checked to ensure high quality and stability of products. The introduction of advanced production equipment and testing instruments to ensure that each batch of products meet international standards and customer requirements. As a biotechnology company facing the global market, the products of Shanxi Qianyecao Biotechnology Co., Ltd. are exported to many countries and regions, and have won widespread praise and trust from customers. We always adhere to the principle of "quality first, customer first", customer-oriented, providing personalized product customization and solutions to meet the diverse needs of different customers. Looking to the future, Shanxi Qianyecao Biotechnology Co., Ltd. will continue to increase investment in research and development, and constantly expand new application fields and market space. Driven by technological innovation and guided by market demand, we will continuously improve product quality and service level, and strive to become a global leader in the field of chemical product research and development and production. At the same time, we also look forward to working with more partners to create a better future.
  • Inquiry History
    3 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.