Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > 99% purity LL37 CAS 154947-66-7 with factory price
99% purity LL37 CAS 154947-66-7 with factory price buy - large image1
99% purity LL37 CAS 154947-66-7 with factory price buy - image1
99% purity LL37 CAS 154947-66-7 with factory price buy - image2
99% purity LL37 CAS 154947-66-7 with factory price buy - image3
99% purity LL37 CAS 154947-66-7 with factory price buy - image4
99% purity LL37 CAS 154947-66-7 with factory price buy - image5
99% purity LL37 CAS 154947-66-7 with factory price buy - image6

99% purity LL37 CAS 154947-66-7 with factory price

TDS 3 Inquiries

Unit Price: Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

TIANJIN

Brand:

TR

Packaging:

5mg/vial 10mg/vial 15mg/vial

Price valid (until):

2025-08-20

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Chemical,Peptide

  • Product Description

  • Seller Information

  • Inquiry History

  • Description

    GLP-1 Tirzepatide 10 mg 15mg Weight Loss Peptide 10mg 99.9% CAS: 2023788-19-2  


    Cas No. 2023788-19-2 SDF
    Formula C225H348N48O68 M.Wt 4813.45
    Solubility Soluble in DMSO Storage Store at -20°C
    General tips For obtaining a higher solubility, please warm the tube at 37 ℃ and shake it in the ultrasonic bath for a while. Stock solution can be stored below -20℃ for several months.
    Shipping Condition Secure

    Appearance: Powder

    Purity: >98% (or refer to the Certificate of Analysis)

    Shipping Condition: Shipped under ambient temperature as non-hazardous chemical. This product is stable enough for a few weeks during ordinary shipping and time spent in Customs.

    Storage Condition: Dry, dark and at 0 - 4 C for short term (days to weeks) or -20 C for long term (months to years).

    Solubility: To be determined

    Shelf Life: >2 years if stored properly

    Drug Formulation: To be determined

    Stock Solution Storage: 0 - 4 C for short term (days to weeks), or -20 C for long term (months).

    HS Tariff Code: 2934.99.9001


    Items Specifications
    Name Tirzepatide 
    Cas :2023788-19-2  
    Appearence White Powder
    Shop 99% purity LL37 CAS 154947-66-7 with factory price-Detailed Image 1
    Shop 99% purity LL37 CAS 154947-66-7 with factory price-Detailed Image 2
    Shop 99% purity LL37 CAS 154947-66-7 with factory price-Detailed Image 3
    Shop 99% purity LL37 CAS 154947-66-7 with factory price-Detailed Image 4
    Shop 99% purity LL37 CAS 154947-66-7 with factory price-Detailed Image 5

    Why choose us  

    1. All peptides and raws purity >=99% purity

    Many HPLC test reports are available (Janoshik).
    2. 100% Safe delivery
    3. Oversea warehouses and stocks: USA, Canada, Europe and Australia.
    4. Cheapest prices in the market, unbeatable!
    5. Payment options: Credit card, bank transfer, wise, alipay, apple pay, google pay, wechat, bitcoin,usdt,Remitly,Money gram.


    FAQ

    Q1: May I get one sample before placing order?

    Re: Yes, Sample are available. For normal products, samples are for free and you just need to bear the freight; For those high value products, you just need to freight and certain product cost. When we both cooperate for some times or when you are our VIP customer, free sample will be offered when you need.

    Q2: Which payment is available for your company?

    Re: Credit card, bank transfer, wise, alipay, apple pay, google pay, wechat, bitcoin,usdt,Remitly,Money gram etc. You can choose the one which is convenient for you.

    Q3: How and when can I get my goods after payment?

    Re: For small quantity products, they will be delivered to you by international courier(DHL, FedEx, TNT etc.) or by air. Usually it will cost 5-7days that you can get the goods after delivery.For large quantity products, shipping by see is worthwhile.It will cost 15 to 30 days to come to your destination port, which depends on where the port is.

    Q4: Is there any possible to use my appointed label or package?

    Re: Yes. If needed, we'd like to.

    ECHEMI Editorial Reference
    LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.

    Certificates
    • 99% purity LL37 CAS 154947-66-7 with factory price Certificates 1 TDS

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Chemical,Peptide

    Location:

    Building Shenglong, Zhongyuan District, Zhengzhou, Henan Province, China.

    Payment Terms:

    TT against copy of documents,L/C,TT against B/L draft before shipment,100% TT in advance

    Average lead Time:

    2

    Total Annual Revenue:

    $1 million-$2.5 million

    Total Employees:

    11-50

    Year of Establishment:

    2020

  • Inquiry History
    3 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.