Product
Supplier
Encyclopedia
Inquiry
Home > Active Pharmaceutical Ingredients > Other Chemical Drugs > LL-37 for Sale > LL-37 CAS:154947-66-7 Factory wholesale price, 99% high-quality products, immunomodulator
LL-37 CAS:154947-66-7 Factory wholesale price, 99% high-quality products, immunomodulator buy - large image1
LL-37 CAS:154947-66-7 Factory wholesale price, 99% high-quality products, immunomodulator buy - image1
LL-37 CAS:154947-66-7 Factory wholesale price, 99% high-quality products, immunomodulator buy - image2
LL-37 CAS:154947-66-7 Factory wholesale price, 99% high-quality products, immunomodulator buy - image3
LL-37 CAS:154947-66-7 Factory wholesale price, 99% high-quality products, immunomodulator buy - image4
LL-37 CAS:154947-66-7 Factory wholesale price, 99% high-quality products, immunomodulator buy - image5
LL-37 CAS:154947-66-7 Factory wholesale price, 99% high-quality products, immunomodulator buy - image6

LL-37 CAS:154947-66-7 Factory wholesale price, 99% high-quality products, immunomodulator

1 Inquiries

Unit Price:

$90-100/UNIT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

guangzhou

Brand:

DL

Packaging:

10mg / vial ,10vials/box

Price valid (until):

2026-07-31

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Tirzepatide,Retatrutide,Semaglutide

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


    Name: Luna
    Whatsapp/WeChat: +86 18617657867
    Email: luna@duole-tech.com

    Items Specifications
    Product Name LL-37 
    Purity >99%
    Appearance White Powder
    CAS NO. 154947-66-7
    MOQ 1box

    LL-37 is the only Cathelicidin type antimicrobial peptide in the human body. Its core functions include anti-infection, immune regulation and tissue repair, and it is also associated with various inflammatory diseases.

    Broad-spectrum anti-infection: Kills Gram-positive and Gram-negative bacteria, resists fungi and viruses (such as HSV-1), and can enhance antiviral effects by activating the STING signaling pathway.

    Immune regulation: Attracts inflammatory cells to gather, induces the secretion of cytokines, and regulates the intensity and direction of the immune response.

    Tissue repair: Upregulates components of the tight junctions of the skin barrier, promotes angiogenesis, and facilitates wound healing of the skin.

    Shop LL-37 CAS:154947-66-7 Factory wholesale price, 99% high-quality products, immunomodulator-Detailed Image 1 Shop LL-37 CAS:154947-66-7 Factory wholesale price, 99% high-quality products, immunomodulator-Detailed Image 2 Shop LL-37 CAS:154947-66-7 Factory wholesale price, 99% high-quality products, immunomodulator-Detailed Image 3 Shop LL-37 CAS:154947-66-7 Factory wholesale price, 99% high-quality products, immunomodulator-Detailed Image 4


      Company profile    


    Duole Technology Co., Ltd. We strive for survival, innovation and development through quality. We adhere to the business philosophy of honesty and trustworthiness, uphold the quality policy of "all based on quality standards, with customer satisfaction as the goal, pursuing novelty and people-oriented quality", and continuously improve and perfect ourselves. We are the developers and leaders of green active materials. Professional product production, product transportation and professional team services have enabled us to gain a good reputation worldwide.


    Shop Tirzepatide 2023788-19-2  Factory stock, high-quality peptide products, for weight loss and slimming.-Detailed Image 5 Shop Tirzepatide 2023788-19-2  Factory stock, high-quality peptide products, for weight loss and slimming.-Detailed Image 6 Shop Tirzepatide 2023788-19-2  Factory stock, high-quality peptide products, for weight loss and slimming.-Detailed Image 7 Shop MOTS-c  1627580-64-6  Factory stock available, with favorable prices and high-quality peptides.-Detailed Image 8 Shop DSIP  62568-57-4   Factory stock available, with favorable prices. Sleep-inducing peptide.-Detailed Image 9 Shop LL-37 CAS:154947-66-7 Factory wholesale price, 99% high-quality products, immunomodulator-Detailed Image 10


    Product function


    1. LL37 has been used as an antimicrobial agent to improve wound healing.

    2. LL37 has been used as a vaccine adjuvant to enhance the immune response of vaccines.

    3. LL37 has been used as a therapeutic agent for the treatment of inflammatory diseases such as asthma and cystic fibrosis.

    4. LL37 has been used as an immunomodulator to modulate the immune response and enhance the production of pro-inflammatorycytokines and chemokines.

    5. LL37 has been studied as a potential target for cancer therapy, due to its ability to induce apoptosis and inhibit cancer cell growth.

    6. LL37 has been studied as a potential target for antiviral therapy due to its ability to inhibit the replication of viruses.

    Shop LL-37 CAS:154947-66-7 Factory wholesale price, 99% high-quality products, immunomodulator-Detailed Image 11 Shop LL-37 CAS:154947-66-7 Factory wholesale price, 99% high-quality products, immunomodulator-Detailed Image 12



    Advantage


    1. Any inquiries will be replied within 12 hours.

    2. Dedication to quality, supply & service.

    3. Strictly on selecting raw materials.

    4.  Reasonable & competitive price, fast lead time.

    5. High quality with competitive price.

    6. All purity>99%.

    Shop Tirzepatide 2023788-19-2  Factory stock, high-quality peptide products, for weight loss and slimming.-Detailed Image 10


      Packaging and Transportation   


    Shop Tirzepatide 2023788-19-2  Factory stock, high-quality peptide products, for weight loss and slimming.-Detailed Image 15 Shop Tirzepatide 2023788-19-2  Factory stock, high-quality peptide products, for weight loss and slimming.-Detailed Image 16 Shop Tirzepatide 2023788-19-2  Factory stock, high-quality peptide products, for weight loss and slimming.-Detailed Image 17


      FAQ


    Q1: How can I contact you?

    A: Contact us via email or Whatsapp/telegram.

    Q2: How to send order?

    A: Send order list to us, we quote best price for you, then ship package out and offer tracking nubmer to you after payment send.

    Q3: How to confirm the product quality before placing an order?

    A: You can get some samples of products.  You can also send us the specifications or your requirements, and we will customize the product for you.

    Q4: Do you have samples for our reference?

    A: Sure, we can offer free samples, the customers will pay the freight.

    Q5: Any discount if order more?

    A: Sure, the price is negotiable, you can get much better price if order big quantity.

    Q6: Is there any possible to use my appointed label or package?

    A: Yes. If needed, we'd like to use label or package according to your requirement.

    Q 7 : How to preserve peptides after receiving them?

    A: Peptides in the form of lyophilized powder can be transported at room temperature by vacuum packaging, while polypeptides in the dissolved state need to be refrigerated at 2 ° C - 8 ° C. For long-term storage, peptides should be stored in the form of lyophilized powder store at -20 ° C or -80 ° C in a sealed container with desiccant, which can avoid the degradation of peptides to the greatest extent.

    Q 8 : What is your MOQ?

    A: The minimum quantity we can order is 1 box.

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Other Chemical Drugs

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Tirzepatide,Retatrutide,Semaglutide

    Location:

    Room 1811-A096, Jingu Building, No.319 Jinxing Middle Road, Xihu Street, Yuelu District, Changsha City, Hunan Province

    Payment Terms:

    TT against copy of documents

    Average lead Time:

    2

    Total Annual Revenue:

    $1 million-$2.5 million

    Total Employees:

    11-50

    Year of Establishment:

    2023

    Duole Technology Co., LTD was established in 2020 with strong research and development capabilities and superb synthesis technology, as well as advanced quality control measures. Effectively promote the joint venture and cooperation with the major enterprises, manufacturers, with the idea of industrial development to serve the society and the majority of users. We always adhere to the market demand as the orientation, constantly synthesizing new high-tech chemical products and medical intermediates.

    We always put the value of our customers as our top priority, we focus on high quality, competitive price, flexible order quantity, timely delivery. Our products are mainly exported to European countries, the United Kingdom, the United States, Canada and Australia. Our products are widely recognized and trusted by users.

    We have our own delivery line to Canada, USA, UK, Spain, Poland, Netherland, Germany, Russia, Kazakhstan, Ukraine, etc. Door to door without any customs clearance issues.

    We look forward to your letter, welcome new and old customers to contact us, common development!

  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.