Product
Supplier
Encyclopedia
Inquiry
Home > Biochemical Engineering > Polypeptide > LL-37 for Sale > High quality LL37 99% freeze dried powder cas154947-66-7 senwayer
High quality LL37 99% freeze dried powder cas154947-66-7 senwayer buy - large image1
High quality LL37 99% freeze dried powder cas154947-66-7 senwayer buy - image1
High quality LL37 99% freeze dried powder cas154947-66-7 senwayer buy - image2
High quality LL37 99% freeze dried powder cas154947-66-7 senwayer buy - image3
High quality LL37 99% freeze dried powder cas154947-66-7 senwayer buy - image4
High quality LL37 99% freeze dried powder cas154947-66-7 senwayer buy - image5
High quality LL37 99% freeze dried powder cas154947-66-7 senwayer buy - image6

High quality LL37 99% freeze dried powder cas154947-66-7 senwayer

1 Inquiries

Unit Price:

$112-121/UNIT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

GuangZhou

Brand:

GuangSheng

Packaging:

5mg*10vials

Price valid (until):

2026-12-16

Company Type:
Trader
Location:
China
Qualification:
Main Products:

beaty prodt

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


    Send your message to us

    Our contact information:+8615113866538

    Email:guangsheng3@zgguangsheng.com




    Shop High quality LL37 99% freeze dried powder cas154947-66-7 senwayer-Detailed Image 1
    Shop High quality LL37 99% freeze dried powder cas154947-66-7 senwayer-Detailed Image 2
    Shop High quality LL37 99% freeze dried powder cas154947-66-7 senwayer-Detailed Image 3
    Shop High quality LL37 99% freeze dried powder cas154947-66-7 senwayer-Detailed Image 4



      Product Packaging and transportation  


    Shop High quality LL37 99% freeze dried powder cas154947-66-7 senwayer-Detailed Image 5 Shop High quality LL37 99% freeze dried powder cas154947-66-7 senwayer-Detailed Image 6



    Product Packing:  10mg/vial 10vials/box , 15mg/vial 10vials/box, 20mg/vial 10vials/box (Customized according to customer requirements)30mg/vial 10vials/box (Customized according to customer requirements)

    Shipping Condition:  Shipped under ambient temperature as non-hazardous chemical. This product is stable enough for a few weeks during ordinary shipping and time spent in Customs.Storage Condition: Dry, dark and at 0 - 4 C for short term (days to weeks) or -20 C for long term (months to years).

     

    Why chose us

    We are dedicated to providing high-quality peptides at affordable prices. Our products are produced quickly and safely. Provide samples before regular order. And our products have been spread across Europe, South America, North America, Southeast Asia, Africa and more countries in the world.

    Our goal is to survive by quality and develop by reputation. We adhere to rigorous quality control standards, ensuring high purity and accurate peptide sequences. 

    Constantly strive for high quality products, competitive prices, professional support, effective team, cooperative and honest cooperation, good after-sales work. Meet the new and old customers to buy.

    Our Service:

    1.Cooperate with research institutions, we strictly control the process from raw material to finished product.

    2.The customer comes first, we provide reasonable price, high quality product and prompt shipment.

    3.We can send the goods to your delivery address directly. It is relatively safe and fast.

    4.Quick and clear response to customers questions.

    5.We could make our price discount if you place a substantial order with us.

     

     

     


    FAQ

    Q: How about the price? Can you make it cheaper?
    A: We always take the customer's benefit as the top priority. Price is negotiable under different conditions, we are assuring you to get the most competitive price.

    Q. What's the lead time and shipping ways?
    A: We will delivery to the package by USPS, FEDEX, DHL paket and other dedicated transportation to you after receive your payment, it would take around 10-15 workdays to your address.

    Q: How do i keep the peptides when i receive it ?
    A: Peptides in the form of lyophilized powder can be transported at room temperature by vacuum packaging, while polypeptides in the dissolved state need to be refrigerated at 2°C - 8°C. For long-term storage, peptides should be stored in the form of lyophilized powder store at -20°C or -80°C in a sealed container with desiccant, which can avoid the degradation of peptides to the greatest extent.

     

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Polypeptide

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    beaty prodt

    Location:

    Yongtai Jinli City Plaza, Baiyun District, Guangzhou City, Guangdong Province

    Payment Terms:

    TT against copy of documents,D/P,L/C,D/A,O/A,TT against B/L draft before shipment,100% TT in advance

    Average lead Time:

    30

    Total Annual Revenue:

    Less than $1 million

    Total Employees:

    5-10

    Year of Establishment:

    2023

  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.