 Home > Biochemical Engineering > Polypeptide > LL-37 for Sale > LL37 High Purity And High Quality Factory Direct Sales Peptide 99% Purity

LL37 High Purity And High Quality Factory Direct Sales Peptide 99% Purity buy - large image1

LL37 High Purity And High Quality Factory Direct Sales Peptide 99% Purity buy - image1

LL37 High Purity And High Quality Factory Direct Sales Peptide 99% Purity buy - image2

LL37 High Purity And High Quality Factory Direct Sales Peptide 99% Purity buy - image3

LL37 High Purity And High Quality Factory Direct Sales Peptide 99% Purity buy - image4

LL37 High Purity And High Quality Factory Direct Sales Peptide 99% Purity

Name: LL37 High Purity And High Quality Factory Direct Sales Peptide 99% Purity
Brand: APKX
SKU: pr2603242100
Price: 20 USD
Availability: InStock

TDS 1 Inquiries

Unit Price:

$20-25/G FOB

Get Latest Price 

CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

GUANGZHOU

Brand:

APKX

Packaging:

5 mg/vial

Price valid (until):

2027-10-22

Contact Supplier

 Chat Now

Tianjin Apex Import and Export Trading Co., Ltd.

Company Type:

Trader

Location:

China

Qualification:

Main Products:

peptides

 Visit Store

Product Description
Seller Information
Inquiry History

Description

Product Detail

1. LL37 has been used as an antimicrobial agent to improve wound healing.

2. LL37 has been used as a vaccine adjuvant to enhance the immune response of vaccines.

3. LL37 has been used as a therapeutic agent for the treatment of inflammatory diseases such as asthma and cystic fibrosis.

4. LL37 has been used as an immunomodulator to modulate the immune response and enhance the production of pro-inflammatorycytokines and chemokines.

5. LL37 has been studied as a potential target for cancer therapy, due to its ability to induce apoptosis and inhibit cancer cell growth.

6. LL37 has been studied as a potential target for antiviral therapy due to its ability to inhibit the replication of viruses.

1. Ultra-High Purity
Each batch is synthesized and purified to >99% purity (HPLC), ensuring reliable and reproducible results in sensitive experiments.

2.Accurate Dosing & Consistency
Our peptides are precisely weighed and vacuum-sealed under sterile conditions. Batch-to-batch consistency is rigorously maintained.

3.Endotoxin-Free & Sterile Processing
Manufactured in a cleanroom environment, our peptides are free from endotoxins, microbial contamination, and other impurities that could interfere with cell-based or in vivo studies.

Sales manager: Eira
whatsapp：+8619304441463
Email: sales01@cnspks.com

1. Advanced Manufacturing Capabilities

Cutting-Edge Facilities: High-precision equipment ensuring purity and bioactivity.

Scalable Production: From milligram-scale research peptides to multi-kilogram industrial batches.

2. Innovation & Customer Commitment

Reliable Supply Chain: Competitive pricing & timely global delivery.

Global Reach: Trusted by researchers, pharmaceutical firms & industrial clients worldwide.

Shop Tirzepatide Top Quality Peptides Lyophilized Powder Tirzepatide Fitness and Weight Loss-Detailed Image 1

Shop Oxytocin Best Oxytocin Acetate vials price Pure Oxytocin raw powder CAS 50-56-6-Detailed Image 8

Q1: May I get one sample before placing order?

Re: Yes, Sample are available. For normal products, samples are for free and you just need to bear the freight; For those high value products, you just need to freight and certain product cost. When we both cooperate for some times or when you are our VIP customer, free sample will be offered when you need.

Q2: Which payment is available for your company?

Re: T/T, PayPal,bank transfer etc. You can choose the one which is convenient for you.

Q3: How and when can I get my goods after payment?

Re: For small quantity products, they will be delivered to you by international courier(DHL, FedEx, TNT etc.) or by air. Usually it will cost 5-7days that you can get the goods after delivery.For large quantity products, shipping by see is worthwhile.It will cost 15 to 30 days to come to your destination port, which depends on where the port is.

Q4: Is there any possible to use my appointed label or package?

Re: Yes. If needed, we'd lik

Shop Oxytocin Best Oxytocin Acetate vials price Pure Oxytocin raw powder CAS 50-56-6-Detailed Image 9

1. Expertise in Peptide Synthesis

Extensive Experience: 7 Years of expertise in synthetic peptide development.

Skilled Team: Experts in solid-phase and liquid-phase synthesis.

2. Advanced Manufacturing Capabilities

Cutting-Edge Facilities: High-precision equipment ensuring purity and bioactivity.

Scalable Production: From milligram-scale research peptides to multi-kilogram industrial batches.

3. Innovation & Customer Commitment

Reliable Supply Chain: Competitive pricing & timely global delivery.

Global Reach: Trusted by researchers, pharmaceutical firms & industrial clients worldwide.

4. Ultra-High Purity
Each batch is synthesized and purified to >99% purity (HPLC), ensuring reliable and reproducible results in sensitive experiments.

5.Accurate Dosing & Consistency
Our peptides are precisely weighed and vacuum-sealed under sterile conditions. Batch-to-batch consistency is rigorously maintained.

6.Endotoxin-Free & Sterile Processing
Manufactured in a cleanroom environment, our peptides are free from endotoxins, microbial contamination, and other impurities that could interfere with cell-based or in vivo studies.

Shop Oxytocin Best Oxytocin Acetate vials price Pure Oxytocin raw powder CAS 50-56-6-Detailed Image 10

Shop Oxytocin Best Oxytocin Acetate vials price Pure Oxytocin raw powder CAS 50-56-6-Detailed Image 11

Why Choose Our Peptides?

Quality Assured: Sourced from trusted manufacturers with reliable global distribution, ensuring consistency and potency .
Holistic Support: Complements weight management programs, metabolic health goals, and sleep apnea treatment plans—addressing root causes for lasting impact .
Why Partner with us?

Quality Assurance:

Manufactured in GMP-certified facilities with full traceability and regulatory-aligned documentation.

Flexible Supply:

Available in multiple formats. Consistent lead times with flexible production capacity.

Competitive Edge:

Factory-direct pricing with volume discounts; stable supply chain to meet your market demand.

Technical Support:

Full documentation and formulation guidance.

Items	Specifications
CAS RN	154947-66-7
Appearance	White Powder
Purity	99%
Storage condition	-20℃

Shop High Purity MGF high quality products with favorable price-Detailed Image 12

Shop Tirzepatide Top Quality Peptides Lyophilized Powder Tirzepatide Fitness and Weight Loss-Detailed Image 11

Certificates

Basic Info

Product Name:

LL-37

Other Name:

Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

CAS No.:

154947-66-7

Molecular Formula:

C205H340N60O53

InChIKeys:

POIUWJQBRNEFGX-XAMSXPGMSA-N

Molecular Weight:

EC Number:

211-519-9

Color/Form:

White to off-white

Categories:

Polypeptide

Characteristics

Water Solubility:

Soluble to 1 mg/ml in water

Seller Information

Business Type:
Trader

Main Products:
peptides

Location:
Room 3043, 3rd Floor, Building 15, No. 185 Xinda Road, Wanghailou Street, Hebei District, Tianjin

Payment Terms:
TT against copy of documents,D/P,L/C,D/A,O/A,TT against B/L draft before shipment,100% TT in advance

Average lead Time:
7

Total Annual Revenue:
$10 million-$25 million

Total Employees:
11-50

Year of Establishment:
2025

Certifications:
.,证书

公司简介

Company Profile
We are a modern, rapidly growing biopharmaceutical company specializing in the production of pharmaceuticals, biologics, and nutraceuticals. We offer internationally leading healthcare products, chemicals, electronics, and mining machinery. Our innovative, full-cycle production facilities fully comply with GMP and ISO standards. We are committed to providing high-quality, affordable, innovative products to prevent disease and support healthier lifestyles. We optimize scientific innovation and production technologies to enable our customers to better serve their consumers. We provide a comprehensive range of services and products for the pharmaceutical and nutraceutical industries, from custom development and production of active ingredients to finished dosage forms. With our scale and resources, we offer our customers one-stop solutions to help people get, feel, and stay well.

Inquiry History

1 Inquiries

Country	Product	Purchase Quantity	Date Posted
Indonesia	LL-37	5 MG	Jun 23, 2026

Post an enquiry for this product

More Choices Find All Products for Sale 

Product Name	Grade / Content	Price	Supplier Name	Details
High purity LL37 freeze-dried powder with a purity as high as 99% factory direct sale 154947-66-7	Pharmacy Grade Cosmetics Grade Chemical Grade/99.9	$10/UNIT FOB	Ningbo Shu You plastic Co., LTD	Inquiry
Factory wholesales peptides 154947-66-7 LL37 5mg Peptide with high quatity 20mg	Pharmaceutical Grade/99	$50/MT FOB	Changsha Caoquan	Inquiry
BT5 BT10 375 CU50 CU100 CAS154947-66-7 Original factory stock supply	Cosmetics Grade/99	$1/G FOB	Chengtai Co., Ltd.	Inquiry
Peptide White Powder LL-37 99% Purity LL37 Antimicrobial Peptide CAS:154947-66-7	Pharmaceutical Grade/99	$100-130/UNIT FOB		Inquiry
Antibacterial Protein LL-37 (human)	Research and Industrial Grade/98.00		Hangzhou Go Top Peptide Biotech Co.,Ltd.	Inquiry

LL37 High Purity And High Quality Factory Direct Sales Peptide 99% Purity

Product Description

Seller Information

Inquiry History

Why Choose Our Peptides?

CAS RN

Appearance

White Powder

Purity

99%

Storage condition

More Choices Find All Products for Sale 

Related Searches