Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > LL37 99% freeze dried powder senwayer 375 Quality Peptides Factory Supply
LL37 99% freeze dried powder senwayer 375  Quality Peptides Factory Supply buy - large image1
LL37 99% freeze dried powder senwayer 375  Quality Peptides Factory Supply buy - image1
LL37 99% freeze dried powder senwayer 375  Quality Peptides Factory Supply buy - image2
LL37 99% freeze dried powder senwayer 375  Quality Peptides Factory Supply buy - image3
LL37 99% freeze dried powder senwayer 375  Quality Peptides Factory Supply buy - image4
LL37 99% freeze dried powder senwayer 375  Quality Peptides Factory Supply buy - image5
LL37 99% freeze dried powder senwayer 375  Quality Peptides Factory Supply buy - image6

LL37 99% freeze dried powder senwayer 375 Quality Peptides Factory Supply

TDS 3 Inquiries

Unit Price:

$33-36/UNIT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

shanghai

Brand:

JL

Packaging:

10ml

Price valid (until):

2027-11-23

Company Type:
Trader
Location:
China
Average Lead Time:
15 days
Qualification:
Main Products:

Peptide

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


    WhatsAPP:+85264811447


    Premium Quality for Research, Development, and Industrial Applications
    As a trusted global supplier, we provide a comprehensive range of high-purity peptides and biochemical compounds to support scientific innovation and product development. Our portfolio is designed for researchers, formulators, and manufacturers who require reliable, high-quality materials
    Shop Semaglutide Cartridge only,no pen included-Detailed Image 1
    Shop Semaglutide Cartridge only,no pen included-Detailed Image 2
    Shop Semaglutide Cartridge only,no pen included-Detailed Image 3

    About Product

    Appearance: Powder

    Purity: >99% (or refer to the Certificate of Analysis)

    Shipping Condition: Shipped under ambient temperature as non-hazardous chemical. This product is stable enough for a few weeks during ordinary shipping and time spent in Customs.

    Storage Condition: Dry, dark and at 0 - 4 C for short term (days to weeks) or -20 C for long term (months to years).

    Solubility: To be determined

    Shelf Life: >2 years if stored properly

    Drug Formulation: To be determined

    Stock Solution Storage: 0 - 4 C for short term (days to weeks), or -20 C for long term (months).

    Peptide Storage Guidelines: General Tips

    When storing peptides, remember to:

    • Store peptide in a cold, dry, dark place
    • Avoid repeated freezing and thawing of peptide
    • Avoid overexposure to the air
    • Avoid light exposure
    • Avoid storing peptides in solution long term
    • Aliquot peptide according to experimental requirements

    Shop Semaglutide Cartridge only,no pen included-Detailed Image 4

    Shop Semaglutide Cartridge only,no pen included-Detailed Image 5
    Shop Semaglutide Cartridge only,no pen included-Detailed Image 6
    Factory Footage
    Shop Semaglutide Cartridge only,no pen included-Detailed Image 7
    Shop Semaglutide Cartridge only,no pen included-Detailed Image 8
    Shop Semaglutide Cartridge only,no pen included-Detailed Image 9 Shop Semaglutide Cartridge only,no pen included-Detailed Image 10 Shop Eloralintide 10mg 20mg vial New Products Factory Wholesale Price High Quality Lyophilized Powder Peptide-Detailed Image 11 Shop Eloralintide 10mg 20mg vial New Products Factory Wholesale Price High Quality Lyophilized Powder Peptide-Detailed Image 12

    Why Source From Us?
    Uncompromised Quality & Verification: Every product is accompanied by comprehensive analytical documentation, including Certificates of Analysis (CoA) with HPLC purity data and Mass Spec (MS) confirmation, ensuring identity, purity (>98% typical), and batch-to-batch consistency.
    Research & Industry Focus: Our products serve the specific needs of R&D laboratories, pre-clinical studies, and commercial manufacturing for nutraceutical, cosmetic, and biotech applications.
    Supply Chain Reliability: We ensure secure, discreet, and temperature-controlled global shipping with reliable logistics partners to deliver your materials intact and on time.
    Customization & Scale: We offer flexibility from small-scale research quantities to large-volume bulk supply. Custom blending, specific purities, and private labeling are available for qualified partners.


    Frequently Asked Questions (FAQs)
    Q1: What documentation do you provide to verify product quality?
    A1: We provide a full Certificate of Analysis (CoA) for all products. For peptides, this includes HPLC purity chromatograms and Mass Spectrometry (MS) reports. For compounds like Botulinum Toxin or Cerebrolysin, we provide manufacturer-specific potency and quality control data. This ensures you receive precisely what you order.

    Q2: How are the peptides and blends formulated and shipped?
    A2: Peptides are typically supplied as sterile, lyophilized (freeze-dried) powders in sealed vials for maximum stability. Our proprietary blends (e.g., GLOW series) are precisely weighed and mixed under controlled conditions. All sensitive items are shipped with cold packs in insulated containers to maintain integrity.

    Q3: What is the typical lead time and minimum order quantity (MOQ)?
    A3: For standard in-stock items, lead time is 3-7 business days after order confirmation. MOQ varies by product but starts as low as 10 vial for many research peptides. We offer significant discounts for bulk and recurring commercial orders. Contact us directly for a specific quote.

    Q4: Can you create custom peptide blends or provide specific analogs?
    A4: Yes. Custom synthesis and blending are a core part of our service. We can develop tailored peptide combinations, specific concentrations, or modified analogs to meet your unique research or product development needs. Submit your specifications for a prompt consultation and quote.

    ECHEMI Editorial Reference
    LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.
    Research & Reference Note

    LL37 99% freeze dried powder senwayer 375 Quality Peptides Factory Supply is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals

    Certificates
    • LL37 99% freeze dried powder senwayer 375  Quality Peptides Factory Supply Certificates 1 TDS

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Peptide

    Location:

    zhejiangshengjinhuashiyiwushijiangdongjiedaodongnanlu656hao

    Average lead Time:

    15 days

    Total Annual Revenue:

    $1 million-$2.5 million

    Total Employees:

    5-10

    Year of Establishment:

    2026

    Jielu Trading focuses on the global cross‑border supply chain of high‑end peptide raw materials. Rooted in cutting‑edge biotechnology, we specialize in the selection, quality control, trade and globalized services of peptide products.

    Adhering to strict quality standards and raw material traceability systems, we provide high‑purity and stable peptide raw materials as well as integrated supply‑chain solutions for scientific research, health care and medical aesthetics industries with standardized production and complete compliance qualifications.

    Guided by our brand philosophy With Peptide Power, Integrity Leads Far, Empowering the World, Jielu builds a stable and efficient global trade network with craftsmanship, integrity and global vision. We strive to be an influential benchmark service provider in the worldwide peptide industry, and create a brighter future with global partners.

  • Inquiry History
    3 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.