Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > LL37 99% purity 5 milligrams of peptide powder CAS 154947-66-7 Factory direct sale buy - large image1 LL37 99% purity 5 milligrams of peptide po
LL37  99% purity  5 milligrams of peptide powder  CAS 154947-66-7  Factory direct sale buy - large image1 LL37  99% purity  5 milligrams of peptide po buy - large image1
LL37  99% purity  5 milligrams of peptide powder  CAS 154947-66-7  Factory direct sale buy - large image1 LL37  99% purity  5 milligrams of peptide po buy - image1
LL37  99% purity  5 milligrams of peptide powder  CAS 154947-66-7  Factory direct sale buy - large image1 LL37  99% purity  5 milligrams of peptide po buy - image2
LL37  99% purity  5 milligrams of peptide powder  CAS 154947-66-7  Factory direct sale buy - large image1 LL37  99% purity  5 milligrams of peptide po buy - image3
LL37  99% purity  5 milligrams of peptide powder  CAS 154947-66-7  Factory direct sale buy - large image1 LL37  99% purity  5 milligrams of peptide po buy - image4
LL37  99% purity  5 milligrams of peptide powder  CAS 154947-66-7  Factory direct sale buy - large image1 LL37  99% purity  5 milligrams of peptide po buy - image5
LL37  99% purity  5 milligrams of peptide powder  CAS 154947-66-7  Factory direct sale buy - large image1 LL37  99% purity  5 milligrams of peptide po buy - image6

LL37 99% purity 5 milligrams of peptide powder CAS 154947-66-7 Factory direct sale buy - large image1 LL37 99% purity 5 milligrams of peptide po

TDS 1 Inquiries

Unit Price:

$90-100/UNIT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

guangzhou

Brand:

zwxs

Packaging:

5mg 10mg 30mg per vial;10vial/box

Price valid (until):

2026-09-09

Company Type:
Trader
Location:
China
Qualification:
Main Products:

peptides

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  



    Name :molly
    Whatsapp/wechat:+15131357230
    Email:zwxs5@zwxstech.com


              •    Our products enjoy good reputation both at home and abroad. Our trade partners are around the world, mainly in America,Europe,Australia,South East Asia ,Middle East and South Africa. In order to serve customers well, the company has established special technical department and after-sale service department. We will make careful reply if you get any question.

                The company with all the employees will constantly purse excellent quality, perfect brand and our image, and adheres to our spirit of honesty, diligence, seeking truth and progress and insists on business philosophy of quality as life and service as soul. We will satisfy market demands by top products and better service, and will welcome market challenge forever.

                we specialize in weight loss packages for anyone looking for a total body transformation using a customized peptide package that is tailored just for your body. Our peptides have been around for decades but only to cater to the rich and famous. But now, we have brought their successful, customized treatments to the general public. Patients begin to see results and feel the effects in as quick as three weeks, transforming their bodies and feeling stronger and more energetic. Let us help you get your edge back.

                This program covers everything from fat loss to introductory muscle building. If you have struggled to get weight off and keep it off, this may be a great option for you!

            • Description: 

                LL37, also known as antimicrobial peptide LL-37, is a 37-amino acid at the N-terminal of Cathelicidin protein, named for its original amino acid L-L, and is the only antimicrobial peptide found in humans derived from Cathelicidin.

                LL37 is the main protein in the special granules of neutrophils. It is synthesized and stored in neutrophils in the form of inactivated precursor protein. Ll37 is widely present in bone marrow, testis, neutrophils, monocytes, tongue, esophagus, cervix, vaginal squamous epithelial cells, and epithelial cells of skin, gastrointestinal tract and respiratory tract.Shop LL37  99% purity  5 milligrams of peptide powder  CAS 154947-66-7  Factory direct sale buy - large image1 LL37  99% purity  5 milligrams of peptide po-Detailed Image 1 Shop LL37  99% purity  5 milligrams of peptide powder  CAS 154947-66-7  Factory direct sale buy - large image1 LL37  99% purity  5 milligrams of peptide po-Detailed Image 2 Shop LL37  99% purity  5 milligrams of peptide powder  CAS 154947-66-7  Factory direct sale buy - large image1 LL37  99% purity  5 milligrams of peptide po-Detailed Image 3

              Product Benefits

              Alternative to Antibiotics
              Reduces Antifungal Effects
              Reduces Antiviral Effects
              Treats Issues with Stomach/Gut
              Faster Recovery from Wounds/InjuriesShop LL37  99% purity  5 milligrams of peptide powder  CAS 154947-66-7  Factory direct sale buy - large image1 LL37  99% purity  5 milligrams of peptide po-Detailed Image 4

                The importance of peptides
                  Many active substances in the human body are in the form of peptides. Peptides are involved in various fields of human hormones, nerves, cell growth and reproduction, and their importance is to regulate the physiological functions of various systems and cells in the body, activate the relevant enzyme systems in the body, promote the permeability of intermediate metabolic membranes, or control DNA transcription or affect specific protein synthesis, and ultimately produce specific physiological effects. Peptides are important substances involved in various cell functions in human body. Peptides can be synthesized into cells and regulate their functional activities. Peptides act as neurotransmitters in the body, transmitting information. Peptides can be used as transportation tools in the human body to transport various nutrients and various vitamins, biotin, calcium and trace elements beneficial to the human body to the cells, organs and tissues of the human body. Peptide is an important physiological regulator of the human body, which can comprehensively regulate the physiological function of the human body, enhance and exert the physiological activity of the human body, and it has important biological functions.


    • Shop LL37  99% purity  5 milligrams of peptide powder  CAS 154947-66-7  Factory direct sale buy - large image1 LL37  99% purity  5 milligrams of peptide po-Detailed Image 5 Shop LL37  99% purity  5 milligrams of peptide powder  CAS 154947-66-7  Factory direct sale buy - large image1 LL37  99% purity  5 milligrams of peptide po-Detailed Image 6


    Product name LL-37
    CAS no. 597562-32-8
    Molecular Formula C205H341N61O52
    Molecular Weight 4492.27854

    Shop LL37  99% purity  5 milligrams of peptide powder  CAS 154947-66-7  Factory direct sale buy - large image1 LL37  99% purity  5 milligrams of peptide po-Detailed Image 7 Shop LL37  99% purity  5 milligrams of peptide powder  CAS 154947-66-7  Factory direct sale buy - large image1 LL37  99% purity  5 milligrams of peptide po-Detailed Image 8








      Our Conpany


         Jinan zhiwen BioTechnology Co., Ltd, The company spirit of "customer first, integrity first principle, with a number of enterprises to establish long-term cooperative relations. Adhere to the quality of survival, creation and development, honest, trustworthy business philosophy, adhere to the "everything quality, customer satisfaction, new, people-oriented quality policy, and constantly improve and perfect themselves. To scientific management, advanced equipment, continuous innovation, to meet the needs of customers. Good reputation and high quality products, has been the majority of domestic and foreign merchants consistent trust. Won the trust of our customers and won the praise of customers!

      Our customers are all over the world, mainly selling in the United States, Canada, Australia, the United. Kingdom, the Ne  therlands, Germany, France and other EU countries, Southeast Asia, South America, and Oceania. We also have many customers.
     Our business is based on honesty and mutual trust. Sincerely look forward to establishing long-term mutually beneficial business relationships with customers around the world.

    Shop LL37  99% purity  5 milligrams of peptide powder  CAS 154947-66-7  Factory direct sale buy - large image1 LL37  99% purity  5 milligrams of peptide po-Detailed Image 9




      Why choose us?  


    1. Higher quality products (>=99% purity) for most of peptides and raws. Quality Guaranteed: Many HPLC test reports are available

    2. Domestic warehouses and stocks: USA, Canada, Europe and Australia.

    3. Ship worldwide with safe and secure lines: 100% delivery guaranteed. No worry about Customs issues.

    4. Special Service: Drop-shipping if need.

    5. Cheapest prices in the market, unbeatable!

    6. Double-clearance express, safer and more efficient. 


    Shop LL37  99% purity  5 milligrams of peptide powder  CAS 154947-66-7  Factory direct sale buy - large image1 LL37  99% purity  5 milligrams of peptide po-Detailed Image 10

    Shop Glutathione Direct from the factory, pure and top-notch glutathione whitening freeze-dried powder CAS 70-18-8-Detailed Image 6


      Advantage&shipping  


    Shop Glutathione Direct from the factory, pure and top-notch glutathione whitening freeze-dried powder CAS 70-18-8-Detailed Image 10


     RAQ     


    Q1: How to confirm the Product Quality before placing orders?
    A: By sending you available samples. Or if you have special requirements for the goods, we can prepare samples according to your requirement for confirmation.
    Q2: Can you supply free samples?
    A: Yes, we can provide a free sample, but the shipping cost will be paid by the customers. You can either pay the shipping cost or arrange a courier to collect the samples.
    Q3: How do you treat quality complaints?
    A: All our products are strictly tested by our QC and confirmed by QA; unqualified material will not be released to customers. In case any quality problem is confirmed to be caused by us, we will replace the goods or refund your payment immediately.
    Q4: What's your MOQ ?
    A: For the high value product, our MOQ starts from 1g and generally starts from 10gs. For other low, price product, our MOQ starts from 100g and 1kg.
    Q: Is there a discount ?
    A: Yes, for larger quantity, we always support with better price.
    Q5: How to start orders or make payments ?
    A: You can send our your Purchase order ( if your company has ), or just send a simple confirmation by email or by Trade Manager, and we will send you Proforma Invoice with our bank details for your confirmation, then you can make payment accordingly.


    Certificates
    • LL37  99% purity  5 milligrams of peptide powder  CAS 154947-66-7  Factory direct sale buy - large image1 LL37  99% purity  5 milligrams of peptide po Certificates 1

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    peptides

    Location:

    No. 41-9, Fenghuangshan Road, Beiyuan Street, Tianqiao District, Jinan City, Shandong Province

    Payment Terms:

    TT against copy of documents,D/P,L/C,D/A,O/A,TT against B/L draft before shipment,100% TT in advance

    Average lead Time:

    3

    Total Annual Revenue:

    $1 million-$2.5 million

    Total Employees:

    5-10

    Year of Establishment:

    2026

  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.