Product
Supplier
Encyclopedia
Inquiry
Home > Active Pharmaceutical Ingredients > Vitamins and Minerals Medicines > LL-37 for Sale > LL37 10mg Peptide 99% CAS 154947-66-7 freeze dried powder Lyophilized Powder
LL37 10mg Peptide 99%  CAS 154947-66-7 freeze dried powder Lyophilized Powder buy - large image1
LL37 10mg Peptide 99%  CAS 154947-66-7 freeze dried powder Lyophilized Powder buy - image1
LL37 10mg Peptide 99%  CAS 154947-66-7 freeze dried powder Lyophilized Powder buy - image2
LL37 10mg Peptide 99%  CAS 154947-66-7 freeze dried powder Lyophilized Powder buy - image3
LL37 10mg Peptide 99%  CAS 154947-66-7 freeze dried powder Lyophilized Powder buy - image4
LL37 10mg Peptide 99%  CAS 154947-66-7 freeze dried powder Lyophilized Powder buy - image5
LL37 10mg Peptide 99%  CAS 154947-66-7 freeze dried powder Lyophilized Powder buy - image6

LL37 10mg Peptide 99% CAS 154947-66-7 freeze dried powder Lyophilized Powder

TDS 1 Inquiries

Unit Price:

$60/UNIT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

Shanghai

Brand:

DX

Packaging:

5mg*10vials,10vials/box

Price valid (until):

2028-10-11

Company Type:
Trader
Location:
China
Qualification:
Main Products:

GLP-1,trizepatide,Semaglutide,Retatrutide

  • Product Description

  • Seller Information

  • Inquiry History

  • Description

    Sales :Doris
    whatsapp:+8615130931633
    Email:doris@xtdaxiang.cn

    Sincerely Look Forward To Your Inquiries About Our Products



    Shop LL37 10mg Peptide 99%  CAS 154947-66-7 freeze dried powder Lyophilized Powder-Detailed Image 1 Shop LL37 10mg Peptide 99%  CAS 154947-66-7 freeze dried powder Lyophilized Powder-Detailed Image 2



    Shop Ghk-Cu  Cosmetic Grade cas 49557-75-7 Anti-Aging Peptides Powder for beauty and hair care-Detailed Image 3


    Items Specifications
    Product Name
    LL37
    CAS number   154947-66-7
    Grade Pharmacy Grade


    Shop SS-31 Cosmetic Peptides CAS 736992-21-5 Elamipretide powder  Peptide Powder Cosmetic Raw Material-Detailed Image 4

    Shop SS-31 Cosmetic Peptides CAS 736992-21-5 Elamipretide powder  Peptide Powder Cosmetic Raw Material-Detailed Image 5



       Peptide Storage Guidelines: General Tips

    When storing peptides, remember to:
    • Store peptide in a cold, dry, dark place
    • Avoid repeated freezing and thawing of peptide
    • Avoid overexposure to the air
    • Avoid light exposure
    • Avoid storing peptides in solution long term
    • Aliquot peptide according to experimental requirements


    Shop Minoxidil  Hot Selling Hair Growth Anti-Hair Loss Powder CAS 38304-91-5-Detailed Image 6


    Daxiang Technology Co., Ltd.,  is a high-tech enterprise focusing on the research, development and production of peptide products. The company was established in recent years and is committed to applying advanced biotechnology to the health industry to meet the market's demand for high-quality, high-efficiency peptide products.​

    As a leading peptide manufacturer, Daxiang Technology has a R&D team composed of senior scientists and engineers, which continues to explore and innovate, and is committed to developing safer, more effective, and more market-competitive peptide products. The company's main products cover but are not limited to pharmaceutical grade, food grade and cosmetic grade and other fields, and are widely used in many aspects such as health care, disease prevention, beauty and skin care.​

    In terms of production technology, Daxiang Technology adopts internationally advanced production equipment and technology to ensure that every aspect of the product, from raw material selection, production and processing to finished product packaging, strictly follows relevant national standards and specifications to ensure product quality and safety. At the same time, the company has also established a complete quality management system and after-sales service system to provide customers with all-round, one-stop service support.​

    Daxiang Technology adheres to the corporate philosophy of "technology leads health, quality creates the future" and always adheres to the development path of people-oriented and technological innovation. The company not only focuses on product quality and innovation, but also actively fulfills its social responsibilities and is committed to promoting the development and progress of the health industry.​

    In the future,Daxiang Technology Co., Ltd. will continue to delve into the field of peptide product research and development, continue to explore and make breakthroughs, and strive to become a leader in the global peptide industry and make greater contributions to human health.


    Shop Minoxidil  Hot Selling Hair Growth Anti-Hair Loss Powder CAS 38304-91-5-Detailed Image 7 Shop Minoxidil  Hot Selling Hair Growth Anti-Hair Loss Powder CAS 38304-91-5-Detailed Image 8


    ——Why choose us?——

    We have clients throughout the world.
    1. Professional service and rich experience make customers feel at ease, adequate stock and fast delivery meet their different desire.
    2. Market feedback and goods feedback will be appreciated, meeting customers’ requirement is our principal responsibility.
    3. High quality, competitive price, fast delivery, first-class service gain the trust and praise from all the customers.

    Our Advantages.

    1.High quality with competitive price.
    2. All purity>99%.
    3. We are manufacturer and can provide high quality products with factory price.
    Fast and safe delivery.
    1. Parcel can be sent out in 24 hours after payment tracking number available.
    2. Secure and discreet shipment verious transportation methods for your choice.
    3. Customs pass rate >99%.

    Shop Minoxidil  Hot Selling Hair Growth Anti-Hair Loss Powder CAS 38304-91-5-Detailed Image 9


    ——Payment  Modes——

    Shop Minoxidil  Hot Selling Hair Growth Anti-Hair Loss Powder CAS 38304-91-5-Detailed Image 10

    ——Product transportation——


    Shop Minoxidil  Hot Selling Hair Growth Anti-Hair Loss Powder CAS 38304-91-5-Detailed Image 11

     

    ——FAQ——


    1. How to make an order?
    Send me message and let me know what you need with quantity , then i will calculate to you

    2. What's the lead time and shipping ways?
    We will delivery to the package by USPS, FEDEX, DHL to you after receive your payment, it would take around 5-15 days to your address.

    3. How do i keep the peptides when i receive it ?
    Peptides in the form of lyophilized powder can be transported at room temperature by vacuum packaging, while polypeptides in the dissolved state need to be refrigerated at 2°C - 8°C. For long-term storage, peptides should be stored in the form of lyophilized powder store at -20°C or -80°C in a sealed container with desiccant, which can avoid the degradation of peptides to the greatest extent.


    ——Certificates——



     

    154947-66-7


    Certificates
    • LL37 10mg Peptide 99%  CAS 154947-66-7 freeze dried powder Lyophilized Powder Certificates 1

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    GLP-1,trizepatide,Semaglutide,Retatrutide

    Location:

    Room 2012, No. 6-143, Section 2, Shanghai Road, Guta District, Jinzhou City, Liaoning Province

    Payment Terms:

    TT against copy of documents,100% TT in advance

    Average lead Time:

    2

    Total Annual Revenue:

    $1 million-$2.5 million

    Total Employees:

    11-50

    Year of Establishment:

    2024

     Daxiang Technology Co., Ltd. is a leading manufacturer and global supplier of high-quality peptide-based pharmaceuticals and fine chemicals. We specialize in the research, development, and production of diverse peptide compounds that meet the rigorous standards of the international pharmaceutical and biotechnology industries.
    Our commitment to excellence is reflected in our strictly GMP-compliant manufacturing facilities, ensuring the highest levels of quality, purity, and consistency in every product.
    We always adhere to market demand as our guide, and continually develop and synthesize new high-tech chemical products.
    Leveraging our global footprint, our products are exported to Europe, the Americas, Southeast Asia, Africa, and other regions, serving customers worldwide.
    Driven by innovation and a customer-centric philosophy, Daxiang Technology Co., Ltd. is dedicated to being your trusted partner for premium peptide solutions, supporting advancements in healthcare and technology worldwide.

  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.