Product
Supplier
Encyclopedia
Inquiry
Home > Active Pharmaceutical Ingredients > Digestive System Drugs > LL-37 for Sale > High Quality LL37 154947-66-7 99% Purity Research Grade Lyophilized Powder 5mg/Vial
High Quality LL37 154947-66-7 99% Purity Research Grade Lyophilized Powder 5mg/Vial buy - large image1
High Quality LL37 154947-66-7 99% Purity Research Grade Lyophilized Powder 5mg/Vial buy - image1
High Quality LL37 154947-66-7 99% Purity Research Grade Lyophilized Powder 5mg/Vial buy - image2
High Quality LL37 154947-66-7 99% Purity Research Grade Lyophilized Powder 5mg/Vial buy - image3
High Quality LL37 154947-66-7 99% Purity Research Grade Lyophilized Powder 5mg/Vial buy - image4
High Quality LL37 154947-66-7 99% Purity Research Grade Lyophilized Powder 5mg/Vial buy - image5
High Quality LL37 154947-66-7 99% Purity Research Grade Lyophilized Powder 5mg/Vial buy - image6

High Quality LL37 154947-66-7 99% Purity Research Grade Lyophilized Powder 5mg/Vial

1 Inquiries

Unit Price:

$45-50/UNIT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

HONGKONG

Brand:

SUITAITRADE

Packaging:

5mg/vial, 10vials/box

Price valid (until):

2026-07-29

Company Type:
Trader
Location:
Hongkong, China
Qualification:
Main Products:

peptide,Cosmetics

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


         LL37 (Human, CAS: 154947-66-7) is a 37‑amino‑acid cationic antimicrobial peptide derived from human cathelicidin (CAMP/hCAP18). It is supplied as high‑purity lyophilized powder with purity ≥99% tested by HPLC. This product is for laboratory in‑vitro research only, widely used in immunology, antimicrobial & antiviral research, cell activity analysis, wound healing and related biochemical experiments for research institutions and biotechnology laboratories.

    Shop High Quality LL37 154947-66-7 99% Purity Research Grade Lyophilized Powder 5mg/Vial-Detailed Image 1

    Shop High Quality LL37 154947-66-7 99% Purity Research Grade Lyophilized Powder 5mg/Vial-Detailed Image 2

    Items Specifications
    Name LL37
    CAS Number 154947-66-7
    Grade Pharmaceutical Grade
    Specification 5mg
    Purity ≥99% (Verified by HPLC)
    Appearance White Lyophilized Powder
    Storage Keep sealed at -20°C, away from strong light and moisture; long‑term storage at -20°C to -80°C


      Our Company


        We are an enterprise integrating chemical research and development, production and trading, specializing in the operation of high-quality fine chemical products. 
         Company adopts an advanced management model, possesses a professional R&D team, strong technical strength, a complete quality assurance and control system, excellent sales and after-sales service, forming a complete system from product R&D, production, sales to after-sales service, ensuring the highest quality and timely delivery. 
         We are extremely committed to the collection and research and development of both new and old products. Adhering to the business philosophy of "sincerity and trustworthiness, customer satisfaction first", we follow the path of professional development and have won high praise and a good reputation from customers with excellent product quality and perfect and considerate services. To become a leading import and export enterprise of pharmaceuticals and chemicals in China. Processing capacity: The company has strong technical force and advanced testing equipment, and can provide high-quality products ranging from gram level to kilogram level and ton level. After-sales service: Made in China, reasonable price, superior quality. 24-hour online service. 3. Safe and fast global delivery. 4. High-quality after-sales service with customer satisfaction as the goal.

    Shop High Quality LL37 154947-66-7 99% Purity Research Grade Lyophilized Powder 5mg/Vial-Detailed Image 3

    Shop High Quality LL37 154947-66-7 99% Purity Research Grade Lyophilized Powder 5mg/Vial-Detailed Image 4


      Why choose us?


         1. High purity and reliable quality
         Adopting advanced solid-phase synthesis and multi-stage purification technology, LL37 (Human) reaches purity ≥99%. Strict quality control ensures no harmful impurities, effectively avoiding experimental data deviation, fully meeting high-standard testing requirements of academic laboratories and biotech research projects.
         2. Standard specification for daily experiments
         The 5mg per vial specification perfectly fits conventional laboratory tests and biochemical analysis. Each vial adopts vacuum lyophilization and light-proof sealed packaging, effectively preventing peptide oxidation and activity attenuation during transportation and daily storage.
         3. Strict batch-to-batch quality consistency
         All finished products undergo HPLC purity detection, molecular identity verification and moisture content testing before delivery. Unified production and inspection standards ensure stable and consistent quality among different batches.
         4. Standard global logistics and safe transportation
         We cooperate with experienced international logistics providers. Professional protective packaging is adopted for delivery, full tracking service is provided, and all transportation procedures comply with international import and export regulatory standards.
         5. Adequate inventory and efficient delivery support
         We keep sufficient spot inventory of LL37 (Human). Once payment is confirmed, we will finish sorting and delivery arrangement quickly to shorten the waiting time for laboratory research materials.
         6. Professional technical consultation and after-sales service
         Our professional team provides targeted guidance on reconstitution methods, storage rules and experimental application scenarios during working hours. All customer inquiries will be replied within 8 working hours.
          7. Flexible long-term cooperation and preferential policies
         For clients with long-term cooperation needs and bulk orders, we offer stable discounted prices and customized packaging solutions to reduce overall procurement costs of experimental supplies.


      Shipping & Delivery  


         We offer multiple shipping solutions including dedicated line logistics and FedEx to ensure reliable and fast delivery. This guarantees stable tracking, on-time arrival, and minimal transit delays for your orders.

    Shop DSIP High Purity Peptide Cas number 62568-57-4 5mg 10mg-Detailed Image 4


      CONTACT US


         If you have any inquiry about product specifications, lab research solutions, bulk order discount and logistics arrangement, welcome to send messages to us via official platform chat box during working hours. Our team will reply to you promptly within 8 working hours.
                          Whatsapp: +852 5261 3144
                          Email: huang@suitaitrade.com

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    peptide,Cosmetics

    Location:

    FLAT E19, 10/F, NO .52 HUNG TO ROAD, KWUN TONG HONG KONG

    Payment Terms:

    TT against copy of documents,D/P,L/C,D/A,O/A,TT against B/L draft before shipment,100% TT in advance

    Average lead Time:

    3

    Total Annual Revenue:

    $1 million-$2.5 million

    Total Employees:

    51-100

    Year of Establishment:

    2026

    Introduction to Peptide Manufacturing Factory
    Our peptide manufacturing factory is a professional, standardized and intelligent production base dedicated to the research, development and mass production of high-purity custom peptides and standard peptides. Adhering to strict pharmaceutical and biochemical production standards, we integrate independent R&D, precision production, rigorous quality testing and customized technical services, committing to providing high-quality peptide products and reliable solutions for global customers.
    Equipped with advanced fully automated peptide synthesis production lines, purification systems and freeze-drying equipment, the factory supports multi-scale production ranging from milligram-level laboratory samples to kilogram-level industrial mass production. We cover mainstream synthesis technologies such as solid-phase peptide synthesis and liquid-phase peptide synthesis, and can efficiently customize various complex peptides, including long-chain peptides, cyclic peptides, modified peptides, fluorescent-labeled peptides and phosphorylated peptides. Our product portfolio widely serves biopharmaceutical research, cosmetic raw material development, food additive production, academic scientific research, diagnostic reagent preparation and other fields.
    Quality control is the core of our production management. The factory has built a complete quality management system in line with ISO international standards, with independent professional testing laboratories. We adopt high-performance liquid chromatography (HPLC), mass spectrometry (MS), infrared spectroscopy and other precision testing methods to strictly monitor raw material screening, synthesis reaction, purification treatment, finished product packaging and every production link. This ensures that all peptide products feature high purity, stable properties, accurate molecular weight and low impurity content, meeting the differentiated quality requirements of scientific research experiments and industrial production.
    With a professional technical team composed of senior peptide synthesis engineers and biochemical researchers, we have rich experience in solving difficult peptide synthesis problems and optimizing production processes. While guaranteeing product quality and production efficiency, we continuously optimize production processes, reduce production costs and shorten delivery cycles. In addition, we provide one-stop services including peptide design scheme optimization, technical consultation, after-sales technical support and personalized packaging, winning long-term trust and cooperative relationships with customers at home and abroad.
    Sticking to the development concept of "technology innovation, quality supremacy, customer-oriented", our factory keeps upgrading production equipment and R&D capabilities, and strives to become a competitive professional peptide manufacturing supplier in the global biochemical industry.
  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.