Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > LL37/With a purity of over 99%, it possesses antibacterial, immune-regulating, tissue-repairing, and dual-action anticancer properties.
LL37/With a purity of over 99%, it possesses antibacterial, immune-regulating, tissue-repairing, and dual-action anticancer properties. buy - large image1
LL37/With a purity of over 99%, it possesses antibacterial, immune-regulating, tissue-repairing, and dual-action anticancer properties. buy - image1
LL37/With a purity of over 99%, it possesses antibacterial, immune-regulating, tissue-repairing, and dual-action anticancer properties. buy - image2
LL37/With a purity of over 99%, it possesses antibacterial, immune-regulating, tissue-repairing, and dual-action anticancer properties. buy - image3
LL37/With a purity of over 99%, it possesses antibacterial, immune-regulating, tissue-repairing, and dual-action anticancer properties. buy - image4
LL37/With a purity of over 99%, it possesses antibacterial, immune-regulating, tissue-repairing, and dual-action anticancer properties. buy - image5

LL37/With a purity of over 99%, it possesses antibacterial, immune-regulating, tissue-repairing, and dual-action anticancer properties.

1 Inquiries

Unit Price:

$100-110/UNIT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

上海

Brand:

JL

Packaging:

5mg

Price valid (until):

2027-05-14

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Peptide

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


    CAS No.:154947-66-7
    Purity: >99.0%
    Molecular Formula: C225H348N48O68
    Molecular Weight: 4813.527g/mol
    Application: Weight loss
    Appearance: White Lyophilized powder
    Reconstitution: Required 
    Storage:After reconstitution store at 2°C - 8°C
    Dose: 2mg 5mg 10mg 20mg 30mg  vials
    Package: 10 vials/kit

    Shipping time: usaully 3-10 days
    Shipping method:DHL, USPS, UPS, special line,act


    Welcome to contact Jielu Trading Co., Ltd..

    WhatsApp: +85293524715

    Items Specifications
    CAS NO 154947-66-7
    Purity >99.0%
    Appearance white powder
    • Helps slow food leaving your stomach
    • Helps prevent your liver from making too much sugar
    • Helps the pancreas produce more insul when your blood sugar levels are high
    • Can help control blood glucose
    • Can reduce hyperglycemia, especially after meals
    • Can reduce fasting insul and fasting glucose
    • Can reduce hemoglobin A1c
    • Can decrease appetite and caloric intake, while inhibiting weight gain
    • Has been shown to lower triglyceride levels and oxidative stress from high LDL
    • Has been shown to help induce weight loss in obese patients with higher dosing
    • Helps decrease leptin and increase leptin sensitivity
    • Can increase the conversion of white fat to brown fat
      Shop LL37/With a purity of over 99%, it possesses antibacterial, immune-regulating, tissue-repairing, and dual-action anticancer properties.-Detailed Image 1 Shop LL37/With a purity of over 99%, it possesses antibacterial, immune-regulating, tissue-repairing, and dual-action anticancer properties.-Detailed Image 2 Shop LL37/With a purity of over 99%, it possesses antibacterial, immune-regulating, tissue-repairing, and dual-action anticancer properties.-Detailed Image 3 Shop LL37/With a purity of over 99%, it possesses antibacterial, immune-regulating, tissue-repairing, and dual-action anticancer properties.-Detailed Image 4


    Our Company


    Jielu Trading Co., Ltd..,it is a professional peptide high-tech company integrating research and development, production and service. 
    The beauty peptides developed and produced by the company include: Anti-wrinkle and anti-aging, whitening and Anti-Spot, tighten and repairing, soothing and anti-allergic, promoting hair growth, promoting hair turning black, removing eye bags and dark circles, breast enhancement and slimming and etc. 

    The core team of Jielu  Peptide is composed of senior experts and professors with more than 20 years of experience in the R&D and production of peptides. It has first-class liquid phase synthesis and solid phase synthesis technology, as well as mature and leading separation and purification technology, we are able to provide customers with top quality of GMP standards products.

    We believe only good quality can bring good cooperation, quality is our key spirit during our production, we are warmly welcome clients and partner from all over the world contact us for everlasting cooperation, Jielu Trading Co., Ltd.. will be your strong, sincere and reliable partner in China.


    Shop LL37/With a purity of over 99%, it possesses antibacterial, immune-regulating, tissue-repairing, and dual-action anticancer properties.-Detailed Image 5 Shop LL37/With a purity of over 99%, it possesses antibacterial, immune-regulating, tissue-repairing, and dual-action anticancer properties.-Detailed Image 6 Shop LL37/With a purity of over 99%, it possesses antibacterial, immune-regulating, tissue-repairing, and dual-action anticancer properties.-Detailed Image 7 Shop LL37/With a purity of over 99%, it possesses antibacterial, immune-regulating, tissue-repairing, and dual-action anticancer properties.-Detailed Image 8


      Why Choose us?   


    1. 1. Higher quality products (>=9  9  % purity) for most of peptides and raws. 


    2. Domestic warehouses and stocks: USA, Canada, Europe and Australia.

    3. Ship worldwide with safe and secure lines: 100% delivery guaranteed. No worry about Customs issues.

    4. Special Service: Drop-shipping if need.

    5. Cheapest prices in the market, unbeatable!

    6. Very reputable:In the most famous boards such as Meso Rx forum and Professional muscle forums,with tons of positive reviews and blind lab tests done by our customers.

    7. Many payment options: Credit card, bank transfer, wise, alipay, pay  pal  , apple pay, google pay, wechat, bitcoin, USDT, USDC, ETH To get a full catalog and price list .


       FAQ  


    1.DO YOU ACCEPT SAMPLE ORDER?
    We accept sample orders. We will make samples before mass production, and after sample approved, we'll begin mass production. Doing 100% inspection during production, then do random inspection before packing.

    2.WHAT'S YOUR MOQ?
    Our MOQ is 100g. But usually we accept less quantity such as 100g on the condition that sample charge is 100% paid.

    3.DO YOU SUPPLY PRODUCT REPORT?
    Yes. We'll give you product analysis report before shipping.

    4.IS THERE A DISCOUNT?
    Different quantity has different discount.2.HOW TO CONFIRM THE PRODUCT QUALITY BEFORE PLACING ORDERS?You can get free samples for some products,you only need to pay the shipping cost or arrange a courier to us and take the samples. You can send us your product specifications and requests,we will manufacture the products according to your requests.


      Quality and Service  


    1.Customer Satisfaction is our priority and guarantee for the future.



    2.We co-develop products and projects with our partners.



    3.Place of Origin China with Super quality by reasonable price.



    4.When you meet problems in mineral processing, we can provide technical guidance.



    5.We will ship the goods that you order from us by EMS, DHL, UPS, or FedEx.We will decided to choose which courier depend on Different countries.To find the best way to delivery the goods for

     you.



    6.We will ship the goods within 5days after get your payments.If you want to cancel or change order, please tell

    me within 24hours after you finish the payment...So we both can make the best of the bad bargain.

    Bulk Order: Shipped via sea or air, it's according to your requirement, delivery time is 7-15days after payment



    7.If you have any other questions to consult me.please not hesitate to contact me any times.


      Packing 


    Shop LL37/With a purity of over 99%, it possesses antibacterial, immune-regulating, tissue-repairing, and dual-action anticancer properties.-Detailed Image 9

    Shop LL37/With a purity of over 99%, it possesses antibacterial, immune-regulating, tissue-repairing, and dual-action anticancer properties.-Detailed Image 10 Shop LL37/With a purity of over 99%, it possesses antibacterial, immune-regulating, tissue-repairing, and dual-action anticancer properties.-Detailed Image 11

    Basic Info

    no data available

    Handling and Storage


    Conditions for safe storage, including any incompatibilities

    Store the container tightly closed in a dry, cool and well-ventilated place. Store apart from foodstuff containers or incompatible materials.

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Peptide

    Location:

    zhejiangshengjinhuashiyiwushijiangdongjiedaodongnanlu656hao

    Average lead Time:

    15

    Total Annual Revenue:

    $1 million-$2.5 million

    Total Employees:

    5-10

    Year of Establishment:

    2026

    Jielu Trading focuses on the global cross‑border supply chain of high‑end peptide raw materials. Rooted in cutting‑edge biotechnology, we specialize in the selection, quality control, trade and globalized services of peptide products.

    Adhering to strict quality standards and raw material traceability systems, we provide high‑purity and stable peptide raw materials as well as integrated supply‑chain solutions for scientific research, health care and medical aesthetics industries with standardized production and complete compliance qualifications.

    Guided by our brand philosophy With Peptide Power, Integrity Leads Far, Empowering the World, Jielu builds a stable and efficient global trade network with craftsmanship, integrity and global vision. We strive to be an influential benchmark service provider in the worldwide peptide industry, and create a brighter future with global partners.

  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.