Product
Supplier
Encyclopedia
Inquiry
Home > Cosmetic Ingredient > Soothing > LL-37 for Sale > GHK-CU CU50 CU100 NJ100 NJ500 NJ1000 CAS154947-66-7 High-quality peptide-based drugs
GHK-CU CU50 CU100 NJ100 NJ500 NJ1000 CAS154947-66-7 High-quality peptide-based drugs buy - large image1
GHK-CU CU50 CU100 NJ100 NJ500 NJ1000 CAS154947-66-7 High-quality peptide-based drugs buy - image1
GHK-CU CU50 CU100 NJ100 NJ500 NJ1000 CAS154947-66-7 High-quality peptide-based drugs buy - image2
GHK-CU CU50 CU100 NJ100 NJ500 NJ1000 CAS154947-66-7 High-quality peptide-based drugs buy - image3
GHK-CU CU50 CU100 NJ100 NJ500 NJ1000 CAS154947-66-7 High-quality peptide-based drugs buy - image4
GHK-CU CU50 CU100 NJ100 NJ500 NJ1000 CAS154947-66-7 High-quality peptide-based drugs buy - image5
GHK-CU CU50 CU100 NJ100 NJ500 NJ1000 CAS154947-66-7 High-quality peptide-based drugs buy - image6

GHK-CU CU50 CU100 NJ100 NJ500 NJ1000 CAS154947-66-7 High-quality peptide-based drugs

TDS

Unit Price:

$1/G FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

shenzhen

Brand:

sc

Packaging:

5 mg /10 mg / 15 mg / 20 mg / 30 mg / 10 tubes per box

Price valid (until):

2027-02-23

Company Type:
Trader
Location:
Hongkong, China
Qualification:
Main Products:

tr

  • Product Description

  • Seller Information

  • Description


      Product Detail  


    Business Manager: Hailey
    WhatsApp: +852 4481 4820

    Shop GHK-CU CU50 CU100 NJ100 NJ500 NJ1000 CAS154947-66-7 High-quality peptide-based drugs-Detailed Image 1

                  1. Ultra-High Purity
                              Each batch is synthesized and purified to >99% purity (HPLC), ensuring reliable and reproducible results in sensitive experiments.


                 2.Accurate Dosing & Consistency
                              Our peptides are precisely weighed and vacuum-sealed under sterile conditions. Batch-to-batch consistency is rigorously maintained.


                3.Endotoxin-Free & Sterile Processing
                              Manufactured in a cleanroom environment, our peptides are free from endotoxins, microbial contamination, and other impurities that could interfere with cell-based or in vivo studies.

    Shop GHK-CU CU50 CU100 NJ100 NJ500 NJ1000 CAS154947-66-7 High-quality peptide-based drugs-Detailed Image 2 The beauty effect of GHK-Cu /Blue Copper peptide:Stimulate the formation of collagen and elastin, firm the skin and reduce fine lines.
    Restore skin repair ability, increase the production of skin cell mucus, and reduce skin damage.
    Stimulate the formation of glucosamine, increase the thickness of the skin, and reduce the looseness and firmness of the skin.
    Promote blood vessel proliferation and increase skin oxygen supply.The auxiliary antioxidant enzyme SOD has a strong and beneficial anti-free radical function.
    Expanding hair follicles accelerates hair growth and inhibits hair loss.
    Stimulate the production of melanin in hair,
    regulate the energy metabolism of hair follicle cells, remove free radicals on the skin, and inhibit the active function of
    stimulating 5-α reduction enzymes.
    Shop GHK-CU CU50 CU100 NJ100 NJ500 NJ1000 CAS154947-66-7 High-quality peptide-based drugs-Detailed Image 3

                 Why Choose Us
                        •High quality products: We have rich experience in production and processing, strict quality inspection.

                        •Reasonable prices: Factory direct, reasonable price and negotiable.

                        •Processing customization: OEM/ODM is acceptable, at the same time, we support the customization of product specifications

                        •Quick response: We will reply to your message within 24 hours.

                        •Good after-sales service: we have a professional team to solve the problems you encounter in the process of using the products.

    Shop GHK-CU CU50 CU100 NJ100 NJ500 NJ1000 CAS154947-66-7 High-quality peptide-based drugs-Detailed Image 4

    ------FAQ------
    Q1.Can I have a sample order?

    A: Yes, welcome to place an sample order to check quality or market.

    Q2.What's the sample and goodslead time?

    A:The stock sample for l day,custom sample for 7-10 days,bulk order for 20-25 days.

    Q3.Do you have any MOQ limit?

    A:yes,the MOQ is 100pcs but any trial order is welcome.

    Q4.How do you ship the goods and how long does it take to arrive?

    A:According to your order quantity,usually ship by sea or by air and by express,20-30 days by sea,5-7 days by air and 3-5 days byexpress.

    Q5.How to proceed an order?

    A: Firstly let us know your requirements. Secondly We quote according to your requirements or our suggestions. Thirdly customer confirm the artworks and pay deposit for formal order.Fourthly We arrange the production & shipment then you pay balance to us.

    Q6.Is it OK to print my logo on the product?

    A: Yes.Please provide the logo Al file so that our designer can make the mock up for you approval.

    Q7: Can you support custom packing?

    A: Sure,custom poly bag with warning text,gift box or display box is welcome.

    Shop GHK-CU CU50 CU100 NJ100 NJ500 NJ1000 CAS154947-66-7 High-quality peptide-based drugs-Detailed Image 5

                    lntroduce

                         Our products enjoy good reputation both at home and abroad. Our trade partners are around the world, mainly in America,Europe,Australia,South East Asia ,Middle East and South Africa. In order to serve customers well, the company has established special technical department and after-sale service department. We will make careful reply if you get any question.

                         The company with all the employees will constantly purse excellent quality, perfect brand and our image, and adheres to our spirit of honesty, diligence, seeking truth and progress and insists on business philosophy of quality as life and service as soul. We will satisfy market demands by top products and better service, and will welcome market challenge forever.

    Shop GHK-CU CU50 CU100 NJ100 NJ500 NJ1000 CAS154947-66-7 High-quality peptide-based drugs-Detailed Image 6

                 These products are APIs (Active Pharmaceutical Ingredient) and not a finished drug. 

                 It is intended strictly for research and laboratory use only.

                 Buyers are required to fully comply with all applicable laws and regulations regarding the handling and use of this material.

    Shop GHK-CU CU50 CU100 NJ100 NJ500 NJ1000 CAS154947-66-7 High-quality peptide-based drugs-Detailed Image 7
    Shop GHK-CU CU50 CU100 NJ100 NJ500 NJ1000 CAS154947-66-7 High-quality peptide-based drugs-Detailed Image 8
    Shop GHK-CU CU50 CU100 NJ100 NJ500 NJ1000 CAS154947-66-7 High-quality peptide-based drugs-Detailed Image 9
    Shop GHK-CU CU50 CU100 NJ100 NJ500 NJ1000 CAS154947-66-7 High-quality peptide-based drugs-Detailed Image 10

    Certificates
    • GHK-CU CU50 CU100 NJ100 NJ500 NJ1000 CAS154947-66-7 High-quality peptide-based drugs Certificates 1

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Soothing

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    tr

    Location:

    B27 SHING LEE COMM BLDG 8WING KUT ST CENTRAL HONGKONG

    Total Annual Revenue:

    Less than $1 million

    Total Employees:

    5-10

    Year of Establishment:

    2026

  • Country Product Purchase Quantity Date Posted
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.