Product
Supplier
Encyclopedia
Inquiry
Home > Biochemical Engineering > Polypeptide > LL-37 for Sale > Research grade LL37 peptide for in vitro biochemical and cell experiments
Research grade LL37 peptide for in vitro biochemical and cell experiments buy - large image1
Research grade LL37 peptide for in vitro biochemical and cell experiments buy - image1
Research grade LL37 peptide for in vitro biochemical and cell experiments buy - image2
Research grade LL37 peptide for in vitro biochemical and cell experiments buy - image3
Research grade LL37 peptide for in vitro biochemical and cell experiments buy - image4
Research grade LL37 peptide for in vitro biochemical and cell experiments buy - image5
Research grade LL37 peptide for in vitro biochemical and cell experiments buy - image6

Research grade LL37 peptide for in vitro biochemical and cell experiments

3 Inquiries

Unit Price:

$93-97/BOU FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99.9%

Port:

GUANGZHOU

Brand:

brand

Packaging:

5mg/vials 10vials/box

Price valid (until):

2027-05-01

Company Type:
Trader
Location:
Hongkong, China
Qualification:
Main Products:

Tirzepatide,Retatrutide,Semaglutide,GHK-Cu

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Storage Conditions


    • If you're interested, just click "Contact supplier"

    • Unopened Product:
      Store in a sealed, dry, light-proof environment at -20°C.

      Avoid frequent freezing and thawing to maintain peptide stability and activity.

    • Reconstituted Solution:
      After dissolving with sterile water or BAC water, store at 2–8°C and use within 2–3 days.

      For long-term storage, keep at -20°C; freeze-thaw cycles should not exceed 3 times.

    • Transportation:
      Shipped with ice packs and insulated packaging. Short-term temperature fluctuations during transport will not affect product quality.

    • Shelf Life: 2 years under proper storage conditions.
    • Product Introduction

    • LL37 is a long-chain synthetic polypeptide manufactured via mature solid-phase peptide synthesis and multi-step chromatographic purification technologies. It features accurate amino acid sequence, complete molecular structure and excellent batch-to-batch consistency.

    • This polypeptide serves as an essential experimental material in biochemistry, cell biology and molecular biology. It is widely adopted by university laboratories, biotechnology R&D centers and academic research institutions across the world. Within strictly controlled laboratory environments, researchers use LL37 to conduct studies on peptide structural characteristics, binding modes between molecules and biological targets, as well as the operation rules of intracellular biochemical reactions and signal transmission networks.

    • Full-process quality supervision and batch sampling inspection are carried out during production. Complete and traceable test documents are provided for each batch to guarantee stable composition and reliable experimental performance. This product is strictly limited to in vitro laboratory experiments and academic research. It is not developed or supplied for human or animal ingestion, injection, external application or any other non-research purposes. No irrelevant functional descriptions beyond the properties of laboratory research reagents are stated.

    Items Specifications
    CAS NO.  154947-66-7
    Product name LL37
    Purity 99.9%
    Packaging 5mg/vial, 10vials/box
    Payment term Alipay,USDT,USDC, Bitcoin, Bank transfer
    MOQ 10vials
    Shelf life 2 Years
    Certificate COA
    Delivery time within 48 hours after payment
    Shop Research grade LL37 peptide for in vitro biochemical and cell experiments-Detailed Image 1
    Shop Research grade LL37 peptide for in vitro biochemical and cell experiments-Detailed Image 2
    Shop Research grade LL37 peptide for in vitro biochemical and cell experiments-Detailed Image 3
    Shop Research grade LL37 peptide for in vitro biochemical and cell experiments-Detailed Image 4
    Shop Research grade LL37 peptide for in vitro biochemical and cell experiments-Detailed Image 5
    Shop Research grade LL37 peptide for in vitro biochemical and cell experiments-Detailed Image 6
    Shop Research grade LL37 peptide for in vitro biochemical and cell experiments-Detailed Image 7
    Shop Research grade LL37 peptide for in vitro biochemical and cell experiments-Detailed Image 8


    Our Factory & Service Advantages


    1. High Purity & Strict Quality Control
    Each batch is tested by HPLC to ensure purity ≥99%. Full COA, MSDS, TDS, HPLC chromatogram and third-party test reports are available.
    2.Factory Direct Supply & Stable Stock
    Professional peptide manufacturer with large-scale production lines, sufficient inventory, and stable long-term supply.
    3.Flexible OEM & Customization
    Support custom specifications, vial packaging, labeling, and private branding to meet global market demands.
    4.Safe & Discreet International Shipping
    Professional cold-chain logistics with secure packaging. Rich experience in customs clearance to North America, Europe, Southeast Asia, Middle East, etc.
    5.Fast Delivery & Full Documentation
    Quick order processing, timely delivery, and complete certification documents to support your customs clearance and registration.
    6.Professional After-Sales & Technical Support
    24/7 online service, order tracking, usage guidance, and long-term technical support for reliable cooperation.

    Shop Research grade LL37 peptide for in vitro biochemical and cell experiments-Detailed Image 9
    Shop Research grade LL37 peptide for in vitro biochemical and cell experiments-Detailed Image 10


      Superior Storage Performance  


    Equipped with light-proof and moisture-proof sealed packaging, the product maintains stable chemical properties for 24 months when stored at -20°C. Reconstituted solutions also keep good stability within the valid period, adapting to both short-term tests and long-cycle research work.

    ECHEMI Editorial Reference
    LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.
    Research & Reference Note

    Research grade LL37 peptide for in vitro biochemical and cell experiments is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Polypeptide

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Tirzepatide,Retatrutide,Semaglutide,GHK-Cu

    Location:

    RM 701, UNIT 108, 7/F, TWR B NEW MANDARIN PLAZA 14 SCIENCE MUSEUM RD TSIM SHA TSUI HONG KONG

    Year of Establishment:

    2026

  • Inquiry History
    3 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.